KEGG   Rattus norvegicus (rat): 299341Help
Entry
299341            CDS       T01003                                 

Gene name
Apopt1, APOP-1, Apop1, RGD1304719
Definition
(RefSeq) apoptogenic 1, mitochondrial
  KO
K23506  apoptogenic protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    299341 (Apopt1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    299341 (Apopt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2315
Motif
Other DBs
NCBI-GeneID: 299341
NCBI-ProteinID: NP_001032858
RGD: 1304719
Ensembl: ENSRNOG00000011542 ENSRNOG00000058920
UniProt: Q32Q90
Position
6q32
AA seq 193 aa AA seqDB search
MAALRPGSKALRRLLCRSFSGGGVRLARERATERRDAASSRVSRFCPPRQSCHDWIGPPD
KYSNLRPVHFHVPENESPLEQRLRELRQETQEWNQQFWAKQNLSFNKEKEEFIYSRLQAK
GSGPRTESGQRATLDAEEMADFYKDFLSKNFQKHMCYNRDWYKRNFAITFFMGKVALERM
WSKLKQKPKKTSG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcggctttgcggcccggaagcaaagctcttcgccggctgctctgccggtccttctcc
ggcggcggcgttcggctggcccgtgagcgcgctacggagcgcagggatgctgcgtccagc
cgggtctcaagattctgccctccgagacagtcttgccatgattggataggccccccagac
aaatactccaaccttcgtcctgttcattttcatgtccctgaaaatgagtctcctttggag
caaaggcttagggaattgaggcaagaaacgcaggaatggaatcagcagttctgggccaag
cagaatctgtcctttaataaggaaaaggaagagttcatttactcaaggctacaagctaaa
ggctcaggcccgcgaaccgagtcaggccaaagagcaacgctggatgccgaggagatggct
gacttctataaggactttctgagcaagaatttccagaagcacatgtgctataaccgagac
tggtacaagcgcaattttgccatcactttcttcatggggaaggtggccctggagaggatg
tggagcaagctgaagcagaagccaaagaagacaagcggttag

DBGET integrated database retrieval system