KEGG   Rattus norvegicus (rat): 299511Help
Entry
299511            CDS       T01003                                 

Gene name
Rdh16, Rdh2, RoDHII
Definition
(RefSeq) retinol dehydrogenase 16 (all-trans)
  KO
K11154  retinol dehydrogenase 16 [EC:1.1.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00830  Retinol metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    299511 (Rdh16)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     299511 (Rdh16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Motif
Other DBs
NCBI-GeneID: 299511
NCBI-ProteinID: NP_954678
RGD: 735050
Ensembl: ENSRNOG00000029651
UniProt: P50170
Position
7q22
AA seq 317 aa AA seqDB search
MWLYLLALVGLWNLLRLFRERKVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAAC
LTEKGAEQLRSKTSDRLETVILDVTKTESIVAATQWVKERVGNTGLWGLVNNAGISGHLG
PNEWMNKQNIASVLDVNLLGMIEVTLSTVPLVRKARGRVVNVASIAGRLSFCGGGYCISK
YGVEAFSDSLRRELSYFGVKVAIVEPGFFRTDVTNGVTLSSNFQMLWDQTSSEVREVYGE
NYLASYLKMLNGLDQRCNKDLSLVTDCMEHALTSCHPRTRYSAGWDAKFFYLPMSYLPTF
LVDALFYWTSPKPEKAL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgtacctgctggcactggtgggcctgtggaacctcctgcgcttgttcagggag
aggaaggtggtaagccatctccaagacaaatatgtcttcatcacgggctgtgactcaggc
tttgggaacctgctggccagacagctggacaggagaggcatgagggtgctggctgcatgt
ctgactgagaagggagccgagcagctgaggagcaagacatcggacaggctggagacagtg
atccttgatgtcaccaagacagagagtattgtggcagccactcagtgggtgaaggagcga
gttgggaacacaggactctggggcctggtcaacaatgctggcatctccggccacctgggt
cccaatgagtggatgaacaaacagaacattgcaagtgtgctggatgtgaacctgttgggc
atgatcgaggtgactctgagcacggtgcccttagtgaggaaggcgaggggccgtgtggtc
aacgttgccagcatcgcaggccgactgtctttttgtggtggtggttactgcatctccaag
tatggtgtagaggccttctcagactccctcaggagagagctctcctattttggggtcaag
gtggctattgtagagcctggcttcttcaggactgatgtgaccaatggtgtcacattatca
tcaaacttccagatgctgtgggaccagaccagctcagaagtcagggaagtctatggcgag
aactacctggcatcttatctgaaaatgctaaatggattggaccagaggtgcaacaaagat
ctgtctctggtgactgactgcatggagcacgccctgacttcctgtcaccctcgcacccgg
tactcagctggttgggatgccaagttcttctacctccccatgagctatctgcccaccttt
cttgtggatgcccttttctactggacttctccaaagcctgagaaagctctctga

DBGET integrated database retrieval system