KEGG   Rattus norvegicus (rat): 299514
Entry
299514            CDS       T01003                                 

Gene name
Mterf3, Cgi12, Mterfd1
Definition
(RefSeq) mitochondrial transcription termination factor 3
  KO
K15032  mTERF domain-containing protein, mitochondrial
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    299514 (Mterf3)
   03029 Mitochondrial biogenesis [BR:rno03029]
    299514 (Mterf3)
Translation factors [BR:rno03012]
 Eukaryotic type
  Release factors
   299514 (Mterf3)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    299514 (Mterf3)
SSDB
Motif
Pfam: mTERF
Other DBs
NCBI-GeneID: 299514
NCBI-ProteinID: NP_955419
RGD: 735158
Ensembl: ENSRNOG00000004492
UniProt: Q6P6Q6
Position
7q22
AA seq 409 aa
MALLAQQLSRWFNSVKLSSFIKATQVTKHSAGLGKNASAQALLSSDTCFLQWGIKTDRAL
FSWSSFQSANTTRRKSSTNSTLLPSVSEQPEKIPRLESELPLEELDDLPPLSPLQPVSEE
EAIQIAAYSPLPLSSSTLADYVDHSETLQKLVQLGVDLSKIEKHPDVANLLLRLNFEKDI
KQILLFLKDLGLEDNQLGPFLTKNYAIFSEDLENLKTRVAYLQSKNFSKTDIACMVKNAP
FLLSFSVERLDNRLGFFQKELELSVKKTRDLVVRLPRLLTGSLEPVKENMKVYRLELGFK
HNEIQHMVTKIPKMLTANKRKLTETFDYVHNVMNIPHHIIVKFPQVFNTRVFKIKERHLF
LAYLGKAQYDPAKPNYVSLDKFVSFPDEVFCKEIAKASVNDFEKFLKTL
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggccttgttagcccaacagttatccagatggttcaactcagttaaattgagtagcttc
attaaagccacacaagtcacaaaacactctgcaggactaggaaaaaatgcctcagctcag
gccctgttgtcctctgacacctgctttctccagtggggaattaagactgacagggctttg
ttctcctggagcagtttccagtcggccaacacaactagaagaaagagttctaccaacagc
actctgcttccttcagtgagtgaacagccagagaagatacctaggcttgaatctgagctg
cctctggaagaactggacgacttgcctccgctgtctccgttacagccagtttcagaggag
gaggctattcagattgctgcatactccccgctgcccctttcctcctccacacttgcagat
tacgtagaccattccgagactctacagaagctggtgcagcttggagtagatttgtctaag
atagaaaaacatccagatgtagccaacctccttctaagactgaattttgaaaaagacatt
aagcaaatactgctatttcttaaagatttgggtttagaagataaccaactgggaccattt
ctgacaaaaaattatgctattttctctgaagaccttgaaaatcttaagaccagagtagct
tatctacagtcaaaaaatttcagtaagacagatattgcctgtatggtcaaaaatgcacca
tttctgttgagcttctccgtggaaagactagataacagactgggattttttcagaaagaa
ctggaactgagtgtgaagaagactagagatctggttgttcgtcttccaaggctactaaca
ggaagtctggagcctgtgaaggaaaacatgaaggtttaccgccttgaacttggttttaaa
cataatgaaattcagcatatggtcaccaagatccctaagatgctaactgcaaacaaaaga
aaacttacggagacttttgattatgtacacaatgtgatgaatattccccaccatatcatt
gtcaagttcccacaggtatttaatacaagagtatttaaaattaaagaaagacacttgttt
cttgcctacttgggcaaagcacagtatgatccagcaaaacctaactatgtgtctttggac
aagttcgtatcttttcctgatgaagtattttgtaaagagattgccaaagcttcagtaaac
gattttgagaaattcttaaaaactctttag

DBGET integrated database retrieval system