KEGG   Rattus norvegicus (rat): 299587Help
Entry
299587            CDS       T01003                                 

Gene name
Casp14
Definition
(RefSeq) caspase 14
  KO
K04401  caspase 14 [EC:3.4.22.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    299587 (Casp14)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     299587 (Casp14)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C14: caspase family
   299587 (Casp14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 Com_YlbF
Motif
Other DBs
NCBI-GeneID: 299587
NCBI-ProteinID: NP_001178705
RGD: 1311781
Ensembl: ENSRNOG00000007352
UniProt: D3ZZ65
Position
7q11
AA seq 246 aa AA seqDB search
MDSETINPQPLQEERYDMSGARLALTLCVTKAREGSEVDMDALERMFQYLKFESTMKRDP
TAQQFLDDMDEFQQTIENWKEPVSCAFVVLMAHGEEGFLKGEDGNMVRLEDLFEVLNNKN
CKALRGKPKVYIIQACRGEHRDPGEELPGDELAVIKKKNPPTIPTYTDMIHIYSTVEGFL
SYRHDQKGSGFIQTLTDVFIHKKGSITELLEEITRLMANTEVMQEGKPRKVNPEIQSTLR
KKLYLQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggactcagagacgattaatccccagcccttgcaggaggagagatacgatatgtcgggt
gcccgcctggccctgacgctgtgtgtcaccaaagcccgggagggttctgaggtagatatg
gatgccctagaacgcatgttccagtacctaaaatttgaaagcaccatgaagagggatcct
actgctcagcaatttctggatgatatggatgaatttcagcagaccatagagaattggaaa
gagcctgtcagctgtgccttcgtggtactcatggcacacggcgaggaaggcttcctcaag
ggagaagacgggaatatggtcagactggaagacctttttgaggtcttgaacaacaagaac
tgcaaggccctgagaggcaagccaaaagtgtatatcatccaggcctgcagaggagagcac
agagaccccggtgaggaactacctggagatgaacttgctgtgatcaagaagaaaaacccc
ccaactatcccaacatatacggatatgatccatatctactccacggtagaggggttcctc
tcctatagacatgaccagaaaggctctggcttcatccagaccctgacggatgtgttcatt
cataaaaaaggatccatcacagagctgttagaagagatcacccgacttatggcaaacaca
gaggtgatgcaggagggaaaaccaaggaaagtgaaccccgaaatccaaagcaccctccgg
aagaagctctatctgcaataa

DBGET integrated database retrieval system