KEGG   Rattus norvegicus (rat): 299588Help
Entry
299588            CDS       T01003                                 

Gene name
Olr1086
Definition
(RefSeq) olfactory receptor 1086
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    299588 (Olr1086)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    299588 (Olr1086)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 299588
NCBI-ProteinID: NP_001000419
RGD: 1334014
Ensembl: ENSRNOG00000042262
UniProt: D4A5L0
Position
7q11
AA seq 320 aa AA seqDB search
MERENQTGDRKFLLLGFTEDSDLQSFFFGLLLSMYLVSITGNLLIVLAIVSDHHLHTPMY
FFLSNLSIADIGFTSTTIPKALQNIHTQSKLISFTGCITQIFFFIVFGCLDNLLLTVMAY
DRFMAICHPLHYVVIMNSCFCVMLALGSWIVSVMSSLPETLTVLRLSFCTNMEIPHFFCD
LPEVLKLACSDTLVNNIVIYSITIVIAGFPFSGILLSYSRIFSSILRIPSAGGKYKAVST
CGSHLLVVFLFYSNGLGVYLSSAATSSSRMSLVASLMYTMVTPMLNPFIYSLRNKDMQKA
LGKLLRKIMLLGEGSIAGFP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagaaaaccaaacaggagacagaaagtttctcctcctgggattcacagaagac
tctgacctacagtcattcttctttgggttgcttctctccatgtacctggtcagcatcaca
ggcaacttactcatcgtcttggccatcgtatcagaccaccacctacacacgcctatgtac
ttcttcctctccaacctgtccatagctgacattggcttcacctccaccaccatcccaaag
gctttgcagaatatccacacacaaagcaaactcatctctttcacaggctgtatcacacag
attttttttttcattgtgtttggatgcctggacaatttactcctaacagtgatggcgtat
gaccgctttatggccatctgccatcccctgcactatgtggtcatcatgaattcttgtttc
tgtgtgatgctggcccttggatcatggatagttagtgtcatgagttccctgcccgagacc
ttgactgtgttaaggctatccttctgtacaaatatggaaattccacactttttctgtgat
cttcctgaagtcctgaagcttgcctgttctgatacccttgtcaataacattgtgatatat
tctataactatagtcatagctggtttcccattctctgggattctattgtcatattctcgg
attttctcctccatcttaagaattccttcagctgggggcaagtacaaagccgtttcaacc
tgtgggtctcacctcttggtagtcttcttgttctacagcaatggtcttggggtctacctt
agctccgcagccacatcatcttctagaatgagtctagttgcctcattgatgtacaccatg
gtcactcccatgctgaaccccttcatctacagcctaaggaacaaggacatgcagaaggcc
ttgggaaaactcctcaggaaaatcatgcttcttggtgaagggagcatagcaggattccca
taa

DBGET integrated database retrieval system