KEGG   Rattus norvegicus (rat): 299606
Entry
299606            CDS       T01003                                 

Gene name
Elane, Ela2
Definition
(RefSeq) elastase, neutrophil expressed
  KO
K01327  leukocyte elastase [EC:3.4.21.37]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    299606 (Elane)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    299606 (Elane)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    299606 (Elane)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    299606 (Elane)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    299606 (Elane)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    299606 (Elane)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.37  leukocyte elastase
     299606 (Elane)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   299606 (Elane)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Other peptidases
   299606 (Elane)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   299606 (Elane)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Enzymes
   299606 (Elane)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 299606
NCBI-ProteinID: NP_001100237
RGD: 1307968
Ensembl: ENSRNOG00000033685
UniProt: D4A488
Position
7q11
AA seq 271 aa
MQPTMALHRPSNQTLASMLLALLLVCPALASEIVGGRPAQPHAWPFMVSLQRRGGHFCGA
TLIARNFVMSAAHCVNGRNFQSVQVVLGAHDLRRREPTRQIFSVQRIFENGFDPSRLLND
IVIIQLNGSATINANVQVAELPAQGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVV
TNLCRRRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGFYPDAFAPVA
EFADWINSIIRSHDDRPLTNPKDREREGRTN
NT seq 816 nt   +upstreamnt  +downstreamnt
atgcagcccaccatggctctccaccgaccatccaaccagactctggcttccatgctgctg
gccttgctcctggtctgtccagcactggcctcagagattgttggtggccggccagcccag
ccccatgcttggcccttcatggtgtccctgcagcggcgtggaggtcacttctgtggtgcc
acactcattgccaggaacttcgtcatgtcagcagcccactgtgtgaatggccgaaatttc
cagtcagtgcaagtggtgctgggagcccatgacctgcggcgacgggagcccactcgacaa
atcttctctgtgcagcgcatctttgagaacggctttgacccgtcacgtctcctgaatgac
attgtgattatccagctcaatggctcagctaccattaacgccaatgtgcaggtggctgag
ctgcctgcccagggccagggcgtgggtaacagaactccgtgtgtggccatgggctggggc
aggttgggcacaaacagaccgttgcccagtgtgctccaagagctcaatgtgacagtggtg
actaacctgtgccgccgacgtgtgaatgtatgcactctggtgccacgccggcaggcaggc
atctgctttggggactctggtggacccttggtctgtaacaaccttgtccaaggcattgac
tccttcatccgaggaggctgtggatctggattctacccagatgccttcgcccctgtggct
gagtttgcagactggatcaattccattatccgcagccatgatgaccggccacttaccaat
cccaaagaccgagagagagagggcaggaccaactaa

DBGET integrated database retrieval system