KEGG   Rattus norvegicus (rat): 299626
Entry
299626            CDS       T01003                                 

Gene name
Gadd45b
Definition
(RefSeq) growth arrest and DNA-damage-inducible, beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04115  p53 signaling pathway
rno04210  Apoptosis
rno04218  Cellular senescence
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05216  Thyroid cancer
rno05217  Basal cell carcinoma
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    299626 (Gadd45b)
   04064 NF-kappa B signaling pathway
    299626 (Gadd45b)
   04068 FoxO signaling pathway
    299626 (Gadd45b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    299626 (Gadd45b)
   04210 Apoptosis
    299626 (Gadd45b)
   04115 p53 signaling pathway
    299626 (Gadd45b)
   04218 Cellular senescence
    299626 (Gadd45b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    299626 (Gadd45b)
   05202 Transcriptional misregulation in cancer
    299626 (Gadd45b)
  09162 Cancer: specific types
   05210 Colorectal cancer
    299626 (Gadd45b)
   05212 Pancreatic cancer
    299626 (Gadd45b)
   05225 Hepatocellular carcinoma
    299626 (Gadd45b)
   05226 Gastric cancer
    299626 (Gadd45b)
   05214 Glioma
    299626 (Gadd45b)
   05216 Thyroid cancer
    299626 (Gadd45b)
   05220 Chronic myeloid leukemia
    299626 (Gadd45b)
   05217 Basal cell carcinoma
    299626 (Gadd45b)
   05218 Melanoma
    299626 (Gadd45b)
   05213 Endometrial cancer
    299626 (Gadd45b)
   05224 Breast cancer
    299626 (Gadd45b)
   05222 Small cell lung cancer
    299626 (Gadd45b)
   05223 Non-small cell lung cancer
    299626 (Gadd45b)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    299626 (Gadd45b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    299626 (Gadd45b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     299626 (Gadd45b)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     299626 (Gadd45b)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 299626
NCBI-ProteinID: NP_001008322
RGD: 1309080
Ensembl: ENSRNOG00000019822
UniProt: Q5U3Z2
Position
7q11
AA seq 160 aa
MTLEELVASDNAVQKMQAVTAAVEQLLVAAQRQDRLTVGVYEAAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETLGTNEARDLHCL
LVTNCHTDSWKSQGLVEVASYCEESRGNNQWVPYISLEER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaccctggaagagctggtggcgagcgacaacgcggttcagaagatgcaggcggtgact
gcggcggtggagcagctgctggtggccgcgcagcgtcaggatcgcctcaccgtgggggtg
tacgaggcggccaaactgatgaatgtggaccccgacagcgtggtcttgtgcctgctggcc
atagacgaagaagaggaggatgatattgctctgcaaattcacttcaccctgatccaatcg
ttctgctgcgacaatgacattgacatcgtcagggtatcaggcatgcaaaggctggcgcag
ctcctgggtgagccggcagagactctaggcacaaacgaggcccgagacctgcactgcctc
ctggtcacgaactgtcatacagattcctggaaaagccaaggcttggtggaggtggccagt
tactgtgaagagagcagaggcaataaccagtgggtcccctatatctctctggaggaacgc
tga

DBGET integrated database retrieval system