KEGG   Rattus norvegicus (rat): 299687
Entry
299687            CDS       T01003                                 

Gene name
Ascl4
Definition
(RefSeq) achaete-scute homolog 4
  KO
K09067  achaete-scute complex protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    299687 (Ascl4)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Achaete-Scute
    299687 (Ascl4)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 299687
NCBI-ProteinID: XP_038935995
RGD: 1307533
Ensembl: ENSRNOG00000031493
Position
7
AA seq 145 aa
MEKCKSAGLLALHSPLRASPLGALARREPCRVSARQDTADCARRRPCPSLPPGGVAEPAF
LRQRNERERQRVRCVNEGYARLRQHLPRELAGQRLSKVETLRAAIGYIKQLQELLERHRP
DLNSDGESKASSGASPCSSEPEERG
NT seq 438 nt   +upstreamnt  +downstreamnt
atggaaaaatgcaaatcggctggactgcttgccctgcattccccgctacgagcctcgccg
ctgggcgcgctggcccggagggagccctgcagggtctccgcgcgccaggataccgcggac
tgcgcgcgaagacggccgtgcccgtccctgccgcccgggggcgtcgccgagcccgccttt
ctgcgccaacgcaacgagcgcgagcggcagcgcgtgcgctgtgtgaacgagggctatgcg
cgcctccgccagcacctgccgcgcgagctggctggccagaggctcagcaaggtggagacg
ctgcgcgccgccatcggctacatcaagcaactgcaagagctgctggagcgtcacaggccg
gacctcaacagcgatggcgagtccaaagcgtcctccggagcctcgccctgcagcagcgag
cctgaggagcgtggctag

DBGET integrated database retrieval system