KEGG   Rattus norvegicus (rat): 299707
Entry
299707            CDS       T01003                                 

Gene name
Washc3
Definition
(RefSeq) WASH complex subunit CCDC53
  KO
K18463  WASH complex subunit CCDC53
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    299707 (Washc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    299707 (Washc3)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Others
   WASH complex
    299707 (Washc3)
SSDB
Motif
Pfam: CCDC53 DUF4623
Other DBs
NCBI-GeneID: 299707
NCBI-ProteinID: NP_001100246
RGD: 1563761
Ensembl: ENSRNOG00000005102
UniProt: D3ZKX1
Position
7
AA seq 194 aa
MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSAVCEEKLADLSLRIQ
QIETTLNILDAKLSSIPGLEDVTVDMSPLSVTAVTNGSHSETTAEQLQQNSTQDSGVQQG
EAPSENVLTVAKDPRYARYLKMVQVGVPVMAIRDKMISEGLDPELLEKPDAPVPSGESEK
AIEESSESESSFSD
NT seq 585 nt   +upstreamnt  +downstreamnt
atggatgaggatgggcttcctctcatggggtcaggcatagacctgaccaaggtgccagct
attcaacagaaaagaaccgtggcttttctaaaccagtttgtggtgcacactgtgcagttt
ctcaaccggttttccgcagtttgtgaagagaaactggcagacctttctcttcggattcaa
caaattgaaacaactctcaatattttagatgcgaagctgtcatctatcccaggcctagag
gatgtcacagttgacatgtctcctttaagtgtcactgctgtcacaaatggatcacattct
gaaaccactgctgagcaactgcagcagaacagcacgcaagactccggagtacaacaaggt
gaagcgccatcagaaaatgtcctaactgtagccaaggacccacgatatgccagatacctc
aagatggttcaagtgggtgttccggtgatggcaatcagagacaagatgatctcagaagga
ctagacccagagctactggagaagccagatgctccggtgccgagtggcgagagtgaaaaa
gccatagaagaaagttcagagagtgagtcttccttcagtgactaa

DBGET integrated database retrieval system