KEGG   Rattus norvegicus (rat): 299714
Entry
299714            CDS       T01003                                 

Gene name
Ano4, Tmem16d
Definition
(RefSeq) anoctamin 4
  KO
K19499  anoctamin-4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    299714 (Ano4)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   299714 (Ano4)
SSDB
Motif
Pfam: Anoctamin
Other DBs
NCBI-GeneID: 299714
NCBI-ProteinID: NP_001100248
RGD: 1310252
Ensembl: ENSRNOG00000006841
UniProt: F1M4U7
Position
7q13
AA seq 568 aa
MVHRHALPGSLHWLVCLLVWSHHSGSLPSQVTHLFDNGATVFFAVFMAVWATVFLEFWKR
RRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKERMNPISGKPEPYQAFTDKCSRLIVSAS
GIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNV
LYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLR
LINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEHGTE
RKINFPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRL
DAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGP
CAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHS
LAPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEM
MYEAELERLQKERKERKKNGKAHHNEWP
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggtacacaggcatgctcttcccggcagccttcattggcttgtttgtcttcttgtatgg
agtcaccactctggatcactgccaagtcaggtgacccacctttttgacaacggggctact
gtgttctttgctgtgttcatggcagtctgggccactgttttcctggagttctggaagaga
cgccgagcggtgatcgcttatgactgggatctgattgactgggaagaagaggaggaagaa
atacggccccagtttgaagccaagtattccaagaaagagcggatgaatcccatttcggga
aagccagaaccttatcaggcatttactgataaatgcagcagacttatcgtttctgcatcg
ggaatattcttcatgatctgtgtggtgatcgcggccgtgttcgggatcgtcatttaccgg
gtggtgaccgtgagcactttcgccgcctttaagtgggcgttaatcaggaacaactctcag
gtcgcgaccacagggactgcagtgtgcatcaacttctgtatcattatgctgctgaacgtg
ctctatgaaaaagtcgcactccttctgacaaatctggaacagcctcgcacagaatccgag
tgggagaacagctttaccttgaaaatgttcctttttcagttcgtcaatctgaacagctct
actttttacatcgcattcttccttggaagatttacaggacacccaggtgcctacttgaga
ttgataaacaggtggaggctagaagagtgccaccctagtggatgccttattgatctctgc
atgcaaatgggtattataatggtgctaaagcagacctggaataatttcatggaacttggc
tacccgttaattcagaattggtggactagaagaaaagtccgacaagaacatgggactgaa
aggaaaataaatttcccacagtgggaaaaggactacaatcttcagccgatgaatgcctat
ggactcttcgatgaatacctggaaatgatccttcagttcggattcacaactatctttgtg
gcagcttttcctctagcaccgcttctggccttactgaataacatcattgaaatccgactt
gatgcttacaagtttgtgactcagtggagaaggcctctggcttcgagggccaaggacata
ggaatttggtatggaattctcgaaggcatcgggattctctctgttattacgaacgcgttt
gtcatagcaataacatccgacttcatccctcgcttagtatatgcttataaatatggaccg
tgtgcaggccaaggagaagctgggcagaagtgcatggttggctatgtaaatgccagcttg
tccgtgttccgaatttctgactttgaaaaccggtctgagccagagtctgatggcagtgag
ttctcaggaactcctctgaagtactgcagatatcgggactaccgggacccgcctcattct
ttggctccctatggctacacactgcagttctggcatgtcctcgcagctcggctggctttc
atcattgtgtttgagcacctcgtgttttgtataaagcacctcatttcctatctgatacca
gacctcccgaaagatctaagggaccggatgaggagagagaagtacttgatccaggagatg
atgtatgaggctgaactggaacgcctccagaaagaacggaaggagaggaagaagaatgga
aaagcacatcacaatgagtggccgtga

DBGET integrated database retrieval system