KEGG   Rattus norvegicus (rat): 299732
Entry
299732            CDS       T01003                                 

Symbol
Lta4h
Name
(RefSeq) leukotriene A-4 hydrolase
  KO
K01254  leukotriene-A4 hydrolase [EC:3.3.2.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    299732 (Lta4h)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    299732 (Lta4h)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.6  leukotriene-A4 hydrolase
     299732 (Lta4h)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M1
   299732 (Lta4h)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N E1_DerP2_DerF2 DUF4367
Other DBs
NCBI-GeneID: 299732
NCBI-ProteinID: NP_001025202
RGD: 1311333
Ensembl: ENSRNOG00000004494
UniProt: P30349
Position
7
AA seq 611 aa
MPEVADTCSLASPASVCRTQHLHLRCSVDFARRALTGTAALTVQSQEDNLRSLTLDTKDL
TIEKVVINGQEVKYTLGESQGYKGSPMEISLPIALSKNQEVVIEISFETSPKSSALQWLT
PEQTSGKQHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGEAP
DPEDPSRKIYRFNQRVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFHALGGWGELQNTIKTFGES
HPFTKLVVDLKDVDPDVAYSSIPYEKGFALLFYLEQLLGGPEVFLGFLKAYVEKFSYQSV
TTDDWKSFLYAHFKDKVDLLNQVDWNAWLYAPGLPPVKPNYDVTLTNACIALSQRWVTAK
EEDLNSFSIEDLKDLSSHQLNEFLAQVLQKAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKACMHPVT
AMLVGKDLKVD
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgcctgaggtcgcggatacttgttccttggcttctccagcctcggtctgccgaacccag
cacctccatcttcgctgcagcgtcgacttcgctcgccgggcactgaccgggaccgccgcg
ctcacggtccagtcacaggaggataatctgcgcagcctgactttggatacaaaagacctt
acgatagaaaaagtggtgatcaacggacaagaagtcaaatacactcttggagaaagccag
ggttacaaaggatcgccgatggaaatctcccttcccatcgctctgagcaaaaatcaagag
gtcgttatagagatttccttcgagacatctcccaagtcctcggcccttcagtggctcact
cccgagcagacttcaggaaagcagcatccatacctcttcagtcagtgccaggccatccac
tgcagggcaatcctcccttgccaagacactccttctgtgaagttaacctacaccgcagag
gtatctgtccccaaagaactggtggctctcatgagtgccatccgtgatggagaagcccct
gacccagaagaccccagcaggaagatatacagatttaaccagagggttcccataccgtgc
tacctgattgctttagtcgttggcgctttagaaagcaggcaaattggcccaagaactctg
gtgtggtctgagaaagagcaggtggagaagtctgcttatgaattctctgagactgaatcc
atgcttaaaattgcagaagatctggggggaccctatgtttggggacagtacgacctgttg
gtcctgcccccatccttcccgtacggaggcatggagaatccttgtctcacattcgtaacc
cctactctattggcaggtgacaagtcactctctaatgttattgcacacgaaatatcgcat
agctggacagggaacctagtgactaacaagacttgggatcacttctggttaaacgaagga
cataccgtctatttagagcgccacatttgtgggcggttgtttggggaaaaattcagacat
ttccacgctttaggaggatggggagagctacagaacacgataaagactttcggggagtcc
catcccttcaccaagctcgtggtcgatctgaaggacgtagaccccgatgtggcctactcc
tccattccctacgagaagggcttcgccttgctcttctacctggaacaacttcttggggga
ccggaggtgtttctaggattcctaaaggcttatgtggagaagttttcctaccagagcgta
accactgatgactggaagagtttcctgtatgctcactttaaagataaggtggatcttctc
aatcaagttgattggaatgcctggctctatgctcctggcctgcctcctgtcaaacccaat
tacgatgtgactctcacgaatgcctgcatcgccttaagtcaaagatgggtcactgccaaa
gaggaagatttaaattcattcagcatcgaagacctgaaggacctctcgtcccatcagctg
aatgagttcctggcacaggtgcttcagaaggcacctcttcccttggggcacataaagcga
atgcaagaggtgtacaacttcaatgccattaacaattctgaaatacgattcagatggtta
cggctctgcattcaatcgaagtgggaagaagcaattcctttggccctaaagatggcaact
gaacaaggaaggatgaaatttacacgacctctattcaaggacctcgctgccttcgacaaa
tcccacgatcaagctgtccgcacctaccaggaacataaagcctgtatgcatcccgtgacc
gccatgctggtggggaaagatctgaaagtggattaa

DBGET integrated database retrieval system