KEGG   Rattus norvegicus (rat): 299735Help
Entry
299735            CDS       T01003                                 

Gene name
Amdhd1, RGD1308879
Definition
(RefSeq) amidohydrolase domain containing 1
  KO
K01468  imidazolonepropionase [EC:3.5.2.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00340  Histidine metabolism
rno01100  Metabolic pathways
Module
rno_M00045  Histidine degradation, histidine => N-formiminoglutamate => glutamate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    299735 (Amdhd1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.7  imidazolonepropionase
     299735 (Amdhd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_3 Amidohydro_1
Motif
Other DBs
NCBI-GeneID: 299735
NCBI-ProteinID: NP_001178710
RGD: 1308879
Ensembl: ENSRNOG00000005266
UniProt: D4AAV1
Position
7q13
AA seq 425 aa AA seqDB search
MNGHRLLLENAQQVVLVCARGELYLTGSELRSLAVLEGASLVVGTDGLIKAVGPADIIRR
QFSGETFEERIDCSGKCILPGLVDAHTHPVWAGERVHEFAMKLAGATYMDIHQAGGGINF
TVEHTRQASEEELFRSFQQRLQCMMRAGTTLVECKSGYGLNLETELKMLRVIERARRELH
LSLSATYCGAHSVPKGKTAVEAADDIISHHLPRLKELSEKGELHVDNIDVFCEKGVFDLD
TTRRILEGGKKVGLQINFHGDELHPMKAAELGAELGARAISHLEEVSDEGIAAMAAAQCS
AVLLPTTAYMLRLKQPRARKMLDEGVIVALGSDFNPNAYCFSMPMVMHLACVNMRMSMPE
ALAAATINAAYALGKSHTHGSLEVGKQGDAIIINASRWEHLIYQFGGHQELIDYVITKGK
VIYKK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatggccaccgcctcctgctggagaacgctcagcaagtggtgctggtgtgtgcccgc
ggagagctatatctgacagggtctgagctgcgcagcctggcagtgctggagggcgccagc
ctggtggtgggcactgatgggcttataaaagctgttggccctgctgacattatccgaaga
cagttttccggagaaacgtttgaagaaagaattgattgctctggaaaatgcatcttgcca
ggtttggtggacgcgcacacacatccggtgtgggctggtgaaagagtccatgagtttgca
atgaagttggcaggggccacgtacatggacatccaccaggctggaggagggatcaacttc
acggtggagcacacgcgccaagcctcggaggaggaactgttccgctccttccagcagcgg
ctgcagtgcatgatgagggccggcaccacactggtggagtgcaagagcggatatggcctc
aacctggagacagagctcaagatgctgcgtgtaatcgagcgtgcccggcgggagctgcac
ctcagcctctctgccacttactgtggggctcactcagtacccaaagggaaaactgctgtg
gaagctgctgatgacatcatcagtcaccacctgccaaggctgaaggaactcagcgaaaag
ggggaactgcatgtggacaacatagacgtgttctgtgagaagggcgtctttgatctggat
accaccagaaggattctggaaggtggaaaaaaggtggggttacagatcaacttccacggg
gatgaactccacccaatgaaggccgctgagcttggggcggaactaggagcacgggcgatc
agccacctggaggaagtcagcgatgaaggcatcgctgccatggctgcggcccagtgttcc
gctgtccttctgcccaccacggcctacatgctgaggctgaagcagcctcgcgccaggaag
atgctagatgagggagtcatagttgctctgggcagcgatttcaaccccaacgcgtactgc
ttttccatgcctatggtcatgcacctggcctgtgtgaacatgaggatgtccatgccagag
gctttggccgctgccaccatcaatgcggcttatgcactgggaaagtctcacacccacgga
tctttggaagttggcaagcagggggatgccatcatcatcaatgcatccagatgggagcat
ttgatttaccagtttggaggccatcaagaattaattgattatgttataactaaaggaaaa
gtcatctataaaaagtga

DBGET integrated database retrieval system