KEGG   Rattus norvegicus (rat): 299757Help
Entry
299757            CDS       T01003                                 

Gene name
Nts
Definition
(RefSeq) neurotensin
  KO
K05235  neurotensin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    299757 (Nts)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro-NT_NN RNase_J_C
Motif
Other DBs
NCBI-GeneID: 299757
NCBI-ProteinID: NP_001095851
RGD: 621612
Ensembl: ENSRNOG00000004179
UniProt: G3V6J4
Position
7q21
AA seq 169 aa AA seqDB search
MIGMNLQLVCLTLLAFSSWSLCSDSEEDVRVLEADLLTNMHASKVSKGSPPSWKMTLLNV
CSLINNLNSAAEEAGEMRDDDLVAKRKLPLVLDDFSLEALLTVFQLQKICRSRAFQHWEI
IQEDILDHGNEKTEKEEVIKRKIPYILKRQLYENKPRRPYILKRASYYY
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgataggaatgaaccttcagctggtgtgcctgactctcctggctttcagctcctggagt
ctgtgctcagattcagaagaagatgtgagagtcctggaggcagatctcctgacaaatatg
catgcatcgaaggtcagcaaaggaagtcctccctcttggaaaatgaccttgctcaacgtt
tgcagcctgatcaataacctgaacagcgcagcggaggaagcgggagaaatgcgtgatgac
gaccttgttgcgaaaaggaaacttccccttgtcctggatgactttagcttggaagcgctg
ctgaccgtattccaactccagaagatctgccgcagccgggcctttcaacactgggagata
attcaggaggatatcctcgatcatggcaatgagaaaactgagaaggaagaagtgataaag
agaaaaatcccttatattctgaaacggcagctctatgagaataaacccagaaggccctac
atactcaagagggcctcctactactactga

DBGET integrated database retrieval system