KEGG   Rattus norvegicus (rat): 299809Help
Entry
299809            CDS       T01003                                 

Gene name
Cct2
Definition
(RefSeq) chaperonin containing TCP1 subunit 2
  KO
K09494  T-complex protein 1 subunit beta
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    299809 (Cct2)
   03036 Chromosome and associated proteins [BR:rno03036]
    299809 (Cct2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    299809 (Cct2)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP60 / Chaperonin
   299809 (Cct2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    299809 (Cct2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   299809 (Cct2)
  Exosomal proteins of colorectal cancer cells
   299809 (Cct2)
  Exosomal proteins of bladder cancer cells
   299809 (Cct2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cpn60_TCP1 DUF2529 Ribosomal_S13
Motif
Other DBs
NCBI-GeneID: 299809
NCBI-ProteinID: NP_001005905
RGD: 1359143
Ensembl: ENSRNOG00000021317
UniProt: Q5XIM9
Position
7q22
AA seq 535 aa AA seqDB search
MASLSLAPVNIFKAGADEERAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDAS
LMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKK
IHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFWQDLMNIAGTTLSSKLLTHHKDHFT
KLAVEAVLRLKGSGNLEAIHVIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIA
NTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYP
EQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLI
HFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDPRTVYGGGCSEMLMAHA
VTMLASRTPGKEAVAMESFAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGRITAGLDM
KEGSIGDMAVLGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcctccctttcccttgcacctgttaatatcttcaaggctggagctgatgaagagagg
gcagagacagctcgcctgtcatcctttattggtgccattgccattggagacttggtgaag
agcactttgggaccgaagggcatggataaaattcttctaagcagtggacgggatgcctct
ctgatggtgaccaatgacggtgccaccattctcaaaaacatcggtgttgacaacccagca
gccaaagttctagttgatatgtcaagagttcaggatgatgaagttggtgacggcaccacc
tctgttactgtcttagctgcagagctactccgggaagcggaatctttaattgcaaaaaag
atccatccacagaccatcattgcgggttggagggaagccacaaaggcagcaagagaggcc
ctgctgagctcagctgtggatcatggttctgatgaagtcaaattctggcaagatttaatg
aatattgcaggaacaacattatcctcaaaactccttactcaccacaaggaccactttact
aaattagctgtagaagctgtgctcagactgaaaggctctggcaatctggaggcgatccac
gtcatcaagaagctaggtgggagcctggcagactcctaccttgatgaaggttttctcttg
gataaaaaaattggagtaaatcaaccaaagagaattgaaaatgctaaaattcttattgcg
aatactggcatggatacagacaaaataaagatatttggctctcgggtaagagttgattcc
acagccaaggttgcagagatagaacatgcagaaaaggagaagatgaaggagaaagttgaa
cgtattcttaagcatggaataaactgctttattaacagacagttaatttataattaccct
gaacaactcttcggtgctgctggcgtcatggctattgagcatgcagattttgcaggtgtg
gaacgcctagctcttgtcacaggtggtgaaattgcctctacctttgatcatccagaactt
gtgaagcttggaagttgcaaacttattgaagaagttatgattggggaagataaactcatt
cacttttctggggttgcccttggtgaggcttgtaccattgtacttcgtggtgccactcag
caaattttggatgaggctgaaagatctctgcatgatgccctttgtgttcttgcccaaact
gtaaaagatcctagaacagtttatggaggaggttgttctgagatgctgatggctcatgct
gtgacaatgcttgccagtagaaccccaggaaaagaagccgtagcaatggagtcatttgct
aaggccctgagaatgttgccaacgatcatagctgacaatgcaggctatgacagtgcagat
ctggtggcacagctccgagctgctcacagtgaaggccgtataactgctggactggatatg
aaggaaggcagcattggtgatatggcagtactgggtataaccgagagctttcaagtgaag
cggcaggttcttttgagtgcggcggaagcagcagaggtgattctacgagtggacaacatc
atcaaagcggcaccaaggaaacgtgtccctgatcaccacccctgttaa

DBGET integrated database retrieval system