KEGG   Rattus norvegicus (rat): 299825
Entry
299825            CDS       T01003                                 

Gene name
Gns
Definition
(RefSeq) N-acetylglucosamine-6-sulfatase precursor
  KO
K01137  N-acetylglucosamine-6-sulfatase [EC:3.1.6.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    299825 (Gns)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    299825 (Gns)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.14  N-acetylglucosamine-6-sulfatase
     299825 (Gns)
SSDB
Motif
Pfam: Sulfatase Phosphodiest
Other DBs
NCBI-GeneID: 299825
NCBI-ProteinID: NP_001011989
RGD: 1305877
Ensembl: ENSRNOG00000047350
UniProt: Q5M918
Position
7
AA seq 519 aa
MRLPSAAGPGPGCPSRLPALLLLPLLSGCLGLVGAARRPNVLLLLTDDQDAELGGMTPLK
KTKALIGEKGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQE
PYTFPAILKLVCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSI
NGKARRHGENYSVDYLTDVLANLSLDFLDYKSNSEPFFMMISTPAPHSPWTAAPQYQKAF
PNVIAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIKFLDDAFRRRWQTLLSVDDLVEKLVK
RLDSTGELDNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKML
VSNIDLGPTILDLAGYDLNKTQMDGTSLLPILKGDGNLTWRSDVLVEYQGEGRNVTDPTC
PSLSPGVSQCFPDCVCEDAYNNTYACVRTLSSMWNLQYCEFDDQEVFVEVYNITADPDQI
TNIAKSIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPG
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgcggctcccgtccgcagctgggcccgggccgggctgtcccagccgcctgcccgcgctg
ctgctactgccgctgctgagcggctgcctggggctcgtgggggcggctcgcaggcccaac
gtgttgctgctgctcacggacgaccaggacgcggagctcggcggcatgaccccactaaag
aaaaccaaggccctcatcggagagaaggggatgactttctccagcgcttatgtgcccagt
gctctctgctgccccagcagagccagcatcctgactgggaagtacccacacaaccatcac
gtcgtcaacaacactttggaggggaactgcagtagcaagtcctggcagaagatccaggag
ccatacaccttcccagcgatccttaagttggtgtgcggctatcaaaccttttttgctggg
aagtatttaaatgagtatggagccccagatgcgggtggactggagcacgtgcctctgggc
tggagttactggtatgccctggaaaagaattctaaatactataactacaccctctctatc
aacgggaaggcacgcagacatggcgagaactatagcgtggactacctgacagacgttctg
gccaatctctccctggacttcctggactacaagtccaactctgagccattcttcatgatg
atctccactccagcgccccactcaccgtggacagccgcacctcagtaccagaaggctttc
cccaatgtcatcgcaccgagaaacaagaacttcaacatccatgggacgaacaagcactgg
ttaattaggcaagccaagactcccatgacgaattcctcaataaagttcttagatgacgcc
ttcagaaggaggtggcaaactctgctctcagttgacgatcttgtggaaaaactggtgaag
agattggactcgactggtgagctggacaacacgtacatcttctatacctcagacaatggc
taccatacagggcagttctctttgccaatagacaaacgacaactctatgagtttgatatc
aaagttccactgttggttcgagggcctgggatcaaaccaaaccagacaagcaagatgctg
gtctccaatattgacttgggtcccaccatcctggacctcgctggctatgacctgaacaag
acacagatggacgggacatccctgctgcccatcctgaaaggggacggtaacttaacctgg
aggtcagatgtcctggtggaatatcaaggagaaggccgtaatgtcaccgacccgacctgc
ccttctttgagtcctggagtgtctcaatgtttcccggactgtgtgtgtgaggacgcgtac
aacaatacatatgcttgtgtgaggacactgtcatccatgtggaacctacagtactgtgag
ttcgacgaccaggaggtatttgtagaagtctataacataactgcagatccagaccagatc
accaacattgctaagagtatagaccccgagcttttgggaaagatgaactatcggctgatg
atgctccagtcctgttccgggccaacctgtcgcactccgggggtctttgaccctgggtaa

DBGET integrated database retrieval system