KEGG   Rattus norvegicus (rat): 299850Help
Entry
299850            CDS       T01003                                 

Gene name
Dctn2
Definition
(RefSeq) dynactin subunit 2
  KO
K10424  dynactin 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04962  Vasopressin-regulated water reabsorption
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    299850 (Dctn2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    299850 (Dctn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    299850 (Dctn2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    299850 (Dctn2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     299850 (Dctn2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     299850 (Dctn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamitin ALIX_LYPXL_bnd SF-assemblin ZapB PI_PP_I
Motif
Other DBs
NCBI-GeneID: 299850
NCBI-ProteinID: NP_001004239
RGD: 1303182
Ensembl: ENSRNOG00000025481
UniProt: Q6AYH5
Position
7q22
AA seq 402 aa AA seqDB search
MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELSSTSVEHIIVNPNAAYDKFKDK
RVGTKGLDFSDRIGKTKRTGYESGDYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKI
KTTVKESATEEKLTPVVLAKQLAALKQQLVASHLEKLLGPDAAINLADPDGALAKRLLLQ
LEATKSSKGSSGGKSTGGTPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEATVR
CDQDAQNPLSAGLQGACLMETVELLQAKVNALDLAVLDQVEARLQSVLGKVNEIAKHKAS
VEDADTQNKVHQLYETIQRWSPVASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQM
MASSLKDNTALLTQVQTTMRENLATVEGNFASIDARMKKLGK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccctaaatacgccgatctccccggcattgccaggaacgagccagatgtttat
gaaaccagcgacctacctgaggatgatcaagcagagtttgatgcggaggagctgagcagc
acaagtgtggaacacatcatcgtcaaccccaacgctgcctatgacaagttcaaggacaag
agagtagggacaaaggggcttgatttctcagatcgcattggaaagaccaagaggacagga
tatgagtctggagactatgaaatgcttggagagggtctgggagtaaaggagacaccacag
cagaagtaccaacgactactgcatgaagtccaggagctgacaacggaggtggagaagatc
aagacaacagtgaaggagtcagccactgaggagaagctcacccctgtggtgctggctaaa
cagctggccgctctgaagcagcagctggtagcttcccacctggagaagcttctgggacca
gatgctgccatcaacctcgctgacccagatggagccctagctaagcgcttactgctgcag
ctggaagcaaccaagagcagcaaaggcagctcagggggaaagagcacaggtggcactccc
ccagatagcagccttgtcacttacgaactccactcacggcctgagcaggacaagttctcg
caagctgccaaagttgcagaactcgagaagcgcctgacagagctggaggccactgtccgc
tgtgatcaggatgctcagaatcccctttctgcaggtctacagggagcctgccttatggaa
acggtagaactgttacaggccaaagtgaacgccctggaccttgcagttctggaccaagta
gaggctcgactgcagagtgtcctgggaaaggtgaatgagattgctaagcacaaggcatct
gtggaggacgcagacacacagaataaggtgcaccagctctatgagaccatccagcgctgg
agccctgtggcctccactctccctgagctggtacagagacttgtcaccatcaagcagctt
catgagcaagctatgcagtttggtcagctcctgacacacttggataccacccagcagatg
atggcgagttctcttaaggacaatactgccctcctgacccaggttcagacaacgatgcgt
gaaaacttggccacagttgaggggaattttgccagcattgatgctcgtatgaagaagctg
ggaaagtga

DBGET integrated database retrieval system