KEGG   Rattus norvegicus (rat): 299851Help
Entry
299851            CDS       T01003                                 

Gene name
Mars
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00450  Selenocompound metabolism
rno00970  Aminoacyl-tRNA biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    299851 (Mars)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    299851 (Mars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    299851 (Mars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    299851 (Mars)
Enzymes [BR:rno01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     299851 (Mars)
Amino acid related enzymes [BR:rno01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   299851 (Mars)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    299851 (Mars)
 Prokaryotic type
   Other AARSs
    299851 (Mars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 GST_C GST_C_2 Anticodon_1 GST_C_3 GST_N_2
Motif
Other DBs
NCBI-GeneID: 299851
NCBI-ProteinID: NP_001121131
RGD: 1305321
Ensembl: ENSRNOG00000025459
UniProt: D3Z941
Position
7q22
AA seq 902 aa AA seqDB search
MRLFVSEGSPGSLPVLAAAARARGRAELLISTVGPEECVVPFLTRPKVPVLQLDSGNYLF
SASAICRYFFLLCGWEQDDLTNQWLEWEATELQPVLSAALYCLVVQGKKGEDVLGPLRRV
LTHIDHSLSRQNCPFLAGDTESLADIVLWGALYPLLQDPAYLPEELGALQSWFQTLSTQE
PCQRAAETVLKQQGVLALRPYLQKQPQPQPLPPEGRAVSNEPEEEELATLSEEDIIAAVA
AWEKGLENLPPLQPQQHPVLPVPGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYS
RLRQWNTLYLCGTDEYGTATETKAMEEGLTPQEICDKYHAIHVDIYRWFNISFDTFGRTT
TPLQTKITQDIFQRLLTRGFVLQDTVEQLRCEQCARFLADRFVEGVCPFCGYEEARGDQC
DKCGKLINAIELKRPQCKVCRSHPVVKSSKHLFLDLPKLEKRLEDWLGKTMPGSDWTPNA
RFIIRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWER
WWKNPEQVDLYQFMAKDNVPFHGLVFPCSALGAEDNYTLVKNLIATEYLNYEDGKFSKSR
GIGVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDLLIKNNSELLNNLGNFINRAG
MFVSKFFGGCVPEMVLTHDDRRLVAHVSWELQRYHQLLEKVRIRDALRSILTISRHGNQY
IQVNEPWKRIKGDEMDRQRAGTVTGMAVNIAALLSVMLQPYMPTVSSTIQTQLQLPEAAC
RILATSFICTLPAGHRIGTVSPLFQKLENDQIENLRQRFGGGQAKGSPKPAVVEAVTTAG
SQDIQVLVDEVTKQGNIVRELKAQKADKNQVAAEVAKLLDLKKQLALAEGKPIETPKGKK
KK
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgttcgtgagcgaaggctccccgggtagcctgccggtgctggctgcggccgcg
agggcccggggccgggcggagctgctcatcagcaccgtaggccccgaagagtgtgtggta
ccatttcttacccggcctaaggtccctgtcttgcagctggatagcggcaactacctcttc
tctgctagtgcaatctgccgatatttttttctgttatgcggctgggaacaagatgatctt
accaaccaatggctggaatgggaagcaacagaactgcagccggttctgtctgctgcccta
tactgtctagtggttcaaggcaaaaaaggggaagatgtacttggcccacttcggagagtc
ctgactcacattgatcacagcttgagtcggcaaaactgtcctttcttggcaggggacaca
gaatctctagctgacattgttttgtggggagcactatatcctttactgcaagacccagct
tacctccctgaggagttgggtgccctacaaagctggttccagacactaagtacccaggag
ccatgtcagcgagctgcagagactgtgctgaaacagcagggtgtcctggcactgcgtccc
tacctccaaaaacagccccagccccagcccctacctcctgaggggagagctgtcagcaat
gaacctgaggaggaagagctggctaccctgtctgaggaggacatcattgctgctgttgct
gcttgggagaagggtctggaaaacttacctccactacagccccagcagcatccagtgttg
cctgtgcctggagaaaggaatgtgctcatcacgagtgccctcccttatgtcaacaatgtc
ccccaccttggaaacatcattggctgtgtgctcagtgctgatgtctttgcaaggtactct
cgccttcgccagtggaacaccctctatctgtgtggcacagatgagtatggtactgcgaca
gagaccaaggccatggaagagggtctaaccccacaagaaatctgtgacaaataccacgcc
atacatgttgacatctaccgctggttcaatatatcgtttgatacgttcggtcgcacaacc
actcctctgcagaccaaaatcacacaggacatcttccagaggttgctgacacggggtttt
gtgctgcaagatactgtagagcagcttcgctgtgagcagtgtgcacgtttcttggctgac
cgctttgtggagggagtgtgtcccttttgtggctatgaagaggcccggggtgaccagtgt
gacaagtgtggcaagctcatcaatgccattgagctcaagagacctcagtgcaaagtctgc
cgctcccaccctgtggtgaagtcctcaaagcacctgtttctagacttgcctaagttagag
aagcgcctggaggactggctggggaagacgatgcctggcagtgactggacacccaatgcc
aggttcattattcgatcctggcttcgagatggactcaagccacgatgcatcaccagagac
ctcaaatggggaactcctgtgcccttggaaggttttgaggacaaggtattttatgtctgg
tttgatgctactattggctatctgtccatcacagccaactacacagaccagtgggagaga
tggtggaagaatccagaacaagtggacctttaccagttcatggccaaagacaatgttccc
ttccatggcttggtctttccttgttcagccctaggagctgaggataactacaccttagtc
aagaacctcatcgctacagaatacctgaactacgaggacgggaagttctctaagagccgg
gggataggagtgtttggagacatggcccaagatacagggatccctgctgacatctggcga
ttctatctgctatacattcggcctgagggccaggacagtgccttctcctggacagacttg
ctgattaaaaacaattctgagctgcttaacaacctgggcaacttcatcaatagagctggc
atgttcgtgtctaagttttttgggggttgtgtgcctgagatggtgctgacccacgatgac
agacgcctggtggcacatgtctcctgggaactccagcgctatcaccagctgttggaaaag
gttcggatccgggatgccttgcgcagtatccttaccatatctcggcatggcaaccaatat
attcaagtgaatgagccctggaaacggattaaaggcgatgagatggacaggcagcgggca
ggcacggtgacaggaatggcagtgaacatagctgccttgctgtctgtcatgctccagccg
tacatgcccacagtcagctccaccattcagacccagctccagctcccagaggcagcctgc
cgcatccttgccacaagcttcatttgtaccttaccagcaggccaccgaattggcacagtc
agtcctttgttccagaaattggaaaatgaccagattgaaaatttgaggcagcgctttgga
gggggccaggctaaagggtcccccaagccagcagttgttgaggcagttactacagcaggg
tcgcaggacatacaagtgctggtggatgaggtaaccaaacagggaaacatagttcgggaa
ctgaaagcacagaaggcagacaagaaccaggttgctgcagaagtggctaaactcttggat
ctaaagaaacagttggctttggctgaggggaagcccattgaaactccgaaaggcaagaag
aaaaagtga

DBGET integrated database retrieval system