KEGG   Rattus norvegicus (rat): 299864Help
Entry
299864            CDS       T01003                                 

Gene name
Ebag9
Definition
(RefSeq) estrogen receptor binding site associated, antigen, 9
  KO
K22455  estrogen receptor-binding fragment-associated gene 9 protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    299864 (Ebag9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 299864
NCBI-ProteinID: NP_001009665
RGD: 1307293
Ensembl: ENSRNOG00000004220
UniProt: Q5PQP2
Position
7q31
AA seq 213 aa AA seqDB search
MAITQFRLFKVCTCLATVLSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEW
TSWDEDAPTSVKIEGGTGNAAAQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLSFGV
PDGSTGFSSRLAATQDMPFIHQSSELGDLDTWQENSNAWEEEEDAAWQAEEVLRQQKIAD
REKRAAEQQRKKMEKEAQRLLKKEQNKMGVKLS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggccatcactcagtttcggttatttaaagtttgtacctgcctagcaacagtgttgtcg
ttcctaaagagattaatatgcagatctggcagaggaaggaaattaagtggagaccaaata
actttgcccaccacagttgattattcgtctgtccctaagcagacagacgtggaggagtgg
acttcctgggatgaagatgcacccacaagtgtgaagattgaaggagggactgggaatgca
gcagcgcagcagaactctttggaacaactggagcctgactatttcaaggacatgacacca
actatacggaaaacgcagaaaattgtcattaagaagagagaaccattgagttttggtgtc
ccagatggtagcacaggtttttccagtagattggcagctacacaagatatgccttttatt
catcagtcttcagaattaggtgacttagatacatggcaagaaaatagcaatgcatgggaa
gaggaagaagatgcagcctggcaagcagaagaagttctgaggcagcagaaaattgcagac
agagagaagagagcagcagaacaacaaaggaagaaaatggagaaggaagcacagcgtctg
ctgaagaaggaacaaaacaaaatgggtgtgaagctttcctaa

DBGET integrated database retrieval system