KEGG   Rattus norvegicus (rat): 299897
Entry
299897            CDS       T01003                                 

Gene name
Trps1
Definition
(RefSeq) transcriptional repressor GATA binding 1
  KO
K22040  atypical GATA-binding protein TRPS1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    299897 (Trps1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    299897 (Trps1)
SSDB
Motif
Pfam: GATA zf_C2H2_ZHX Zap1_zf2
Other DBs
NCBI-GeneID: 299897
NCBI-ProteinID: NP_001128309
RGD: 1311883
Ensembl: ENSRNOG00000024998
UniProt: D3ZEM6
Position
7q31
AA seq 1281 aa
MVRKKNPPLRNVASEGEGQTLEPTATESKASGKNKEFSADQMSENTDQSDVAELNTKEEH
STHGQEPSSSSKKDLQISGLSEKAGFNYESPSKGGNLASFPHDEVTDRNMLAFSSPAAGG
VCEPLKSPQRAEADDPQDMACTPSGDSLETKEDHKMSPKATEETGPVQSGQANCQGLSPV
SVASKNPQVPSDGGVRLSKPKSDLLVSDNPDPAPLSPELQDFKCNICGYGYYGNDPTDLI
KHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQKVNRSVLSGVLQDISSSRPA
LLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNFTYMGNSSTELEQHFLQTHPN
KIKVSLPSSEGVKASEKNSNKSIPALRASDSGDVGKWQDKMTVKAGDDTPVGYSVPIKPL
DSSRQNGTEATSYYWCKFCSFSCESSSSLKLLEHYGKQHGAVQSGGLNPELNDKLPRGSV
INQNDLAKSVEGEPLTKPEKGLSGAKKKDFPSKGAEDNMVTSYNCQFCDFRYSKSHGPDV
IVVGPLLRHYQQLHNIHKCTIKHCPFCPRGLCSPEKHLGEITYPFACRKSNCSHCALLLL
HLSPGVAGSSRVKHQCHQCSFSTPDVDVLLFHYETMHESQASDVKQEVNHLLGSEGQQAA
RDSKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFTAGDTQSLLEHFNTVHCQEQE
VATANGEEDGHAIPTIKEEPKIDLKVYSLLNPDSKMGETVPESIVKREKLDDKEGLKDKI
WTESSTDDLRGVTWRGADILRGSPSYTQASLGLLTPVSSSQEQTKTLRDSPNVEAAHLAR
PMYGLAVDTKGFLQGAPAGGEKSASLTQQYPASGEGKTKDESQSLLRRRRGSGVFCANCL
TTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRRRTRKRLNPEALQA
EQLNKQQRGSGEEQVNGSPLERRSEDHLSESHQREIPLPSLSKYEAQGSLTKSHSAQQPV
LVSQTLDIHKRMQPLHIQIKSPQESTGDPGNSSSVSDGKGSSERGSPIEKYMRPAKHPNY
SPPGSPIEKYQYPLFGVPFVHNDFQSEADWLRFWSKYKLSVPGNPHYLSHVPGLPNPCQN
YVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPTANGAAKEKSKAPSNVKNEGPLNVV
KTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFTT
HIQRGLHRNNAQAEKNGKPKE
NT seq 3846 nt   +upstreamnt  +downstreamnt
atggtccggaaaaagaacccccctctgagaaacgttgctagtgaaggcgagggtcaaacc
ctggagccaacagctacagagagcaaggcatctgggaagaacaaagaattttctgcagat
cagatgtcagaaaatacagatcagagtgatgttgcagaattgaacacgaaggaggaacac
agcacgcatggccaagagccgtcttcgagcagtaagaaggacttgcaaatctcaggcctg
agtgagaaggctggcttcaattatgaaagccccagtaagggagggaaccttgcctccttc
ccacatgatgaggtaacagacagaaatatgttggctttctcatctccagctgctggggga
gtctgcgagcccttgaagtctcctcaaagagcagaggcagatgaccctcaagatatggcc
tgcaccccatcaggggattcactggagacaaaggaagatcataaaatgtcaccaaaggcc
actgaggaaacagggccagtgcagagtggtcaagccaattgtcaaggtttgagtccagtt
tccgtggcctcaaaaaacccacaagtgccttcagatgggggtgtcagactgagtaaaccc
aaaagtgacttactggtgagtgacaacccagacccggcacctctgtctccagagcttcag
gactttaaatgcaatatctgtggatacggttactatggcaatgaccccacagatctgatt
aagcacttccgaaagtatcacttaggactgcataatcgcaccaggcaggatgctgagctg
gacagcaaaatcttggcccttcataacatggtgcagttcagccattccaaagacttccag
aaggtcaaccgttctgtgctttctggcgtgctgcaggatatcagctcttcacggcctgcg
ctactaaatgggacctatgatgtacaggtcacttcaggtggaacgttcattggcattgga
cggaaaactcccgattgccaaggcaacaccaagtatttccgctgcaaattctgcaatttc
acttacatgggcaactcgtcaactgaactagaacaacattttcttcagactcacccgaat
aaaatcaaagtgtctctcccgtcctccgagggcgtgaaagcttcagagaaaaactctaac
aaatccatccctgcgcttcgagccagtgactctggggatgtaggaaaatggcaggacaaa
atgacagtcaaagctggagatgacacccctgtcggctactcagtgcccatcaagcccctc
gattcctcacgacaaaatggtacagaggccaccagttattactggtgtaaattttgtagt
ttcagctgtgagtcatctagctcgcttaagctgctagaacattacggcaagcagcatgga
gcagtgcagtcgggcggccttaatccagagttgaatgacaaacttcccaggggctctgtc
attaatcaaaatgatctagccaaaagtgtagaaggagagccattgaccaagccagaaaag
ggcttgagtggggctaaaaagaaggacttccccagcaagggagcagaggataatatggta
acgagctataactgtcagttctgtgactttagatattccaaaagccatggccctgatgtg
attgtagtgggtccacttctccgtcattatcagcaactccataacatccacaagtgtacc
attaagcattgtccattctgtcccagaggcctttgcagcccagaaaagcaccttggagaa
attacttatccgtttgcttgtagaaaaagtaattgttcccactgtgcactcttgctgtta
cacttgtctcctggggtggccggaagttccagagtcaaacaccaatgccaccagtgttcc
ttctctacccccgatgtagatgtgctcctctttcactatgagaccatgcatgagtcccaa
gcatcggatgtcaaacaagaggtaaaccacctgctaggatctgaagggcagcaggctgcc
agggacagcaaggaacactcgtgcaccaaatgtgattttataacccaggtggaagaagag
atctctagacactacaggagagcacacagctgctataaatgtcgtcagtgcagtttcaca
gctggtgacactcagtcactgttggagcacttcaacacggttcactgccaggaacaggaa
gtagctactgctaatggcgaagaggatggccatgccatacccaccatcaaggaagagccc
aaaattgatctcaaggtctacagtctgctaaacccagactctaaaatgggagagacagtt
cccgagagcatagttaagagagagaaacttgatgacaaggaagggctaaaagataaaatc
tggacggagagttcaactgatgaccttcgtggtgtgacttggagaggagccgacatccta
cggggtagtccatcctatactcaagcaagtctggggctcttgacgcctgtgtccagctcc
caagagcagacaaagactctgagggacagccccaatgtcgaagctgcccacctggcccga
cctatgtatggcttggctgtcgataccaagggcttcctgcaaggggctcctgctggtggc
gagaagtctgcatctctcactcagcagtatcctgcttctggagagggcaagaccaaggac
gaatcccagtcgctgttacggaggcgaagaggctctggtgttttttgtgccaattgcctg
accacaaagacctctctctggcgaaagaatgcaaatggcggatatgtatgcaacgcatgt
ggcctctaccagaaacttcactcgactcccaggcctttaaacatcattaaacaaaacaac
ggcgagcagattattagaagacggacaagaaagcgccttaacccagaggcacttcaggct
gagcaactcaacaaacagcagaggggaagtggggaggagcaggtcaatggaagcccctta
gagaggaggtcagaagatcacttaagtgaaagtcatcagagagaaattccacttccgagc
ctgagtaaatacgaagcccagggttcattgactaaaagccattctgctcaacagccggtc
ctggtcagccaaactctggatattcacaaaaggatgcagcctttgcacattcagataaaa
agtcctcaggaaagtactggagatccaggaaacagttcatccgtatctgatgggaaagga
agttctgaaagaggcagccccatagaaaagtacatgaggcctgcaaaacaccccaactat
tctccaccaggcagccccatcgaaaagtaccaatacccactttttggagttccttttgta
cataatgacttccagagtgaagctgattggctacggttctggagtaaatataagctctct
gttcctgggaatccgcactacttgagtcatgtgcctggcttaccaaatccttgccaaaac
tatgtgccttatcccaccttcaatctgcctcctcatttctcagctgttggatcagacaat
gacattcctctagatttggcgatcaagcattccagacctgggccaactgcaaatggtgcc
gccaaggagaaaagcaaggcaccatcaaacgtaaaaaatgaaggtcccttgaatgtagtt
aagacggagaaagttgacagaagcactcaagatgaactttcaacgaaatgtgtgcactgt
ggcattgttttcctggatgaagtgatgtatgctttgcatatgagttgccatggtgacagt
ggacctttccagtgcagcatatgccagcatctttgcacggacaaatatgacttcacaaca
catatccagaggggcctgcataggaacaatgcacaagcagaaaaaaatggaaaacctaaa
gagtaa

DBGET integrated database retrieval system