KEGG   Rattus norvegicus (rat): 299976
Entry
299976            CDS       T01003                                 

Gene name
Rrm2b
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2 B
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno00480  Glutathione metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    299976 (Rrm2b)
   00240 Pyrimidine metabolism
    299976 (Rrm2b)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    299976 (Rrm2b)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    299976 (Rrm2b)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    299976 (Rrm2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    299976 (Rrm2b)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     299976 (Rrm2b)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    299976 (Rrm2b)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 299976
NCBI-ProteinID: NP_001124015
RGD: 1306045
Ensembl: ENSRNOG00000025454
UniProt: D4ADQ1
Position
7
AA seq 351 aa
MGDPERPEAARPEEGEQLCPETKENEVRSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQ
ASFWTAEEVDLSKDLPHWNKLKSEEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEA
RCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRK
STFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ
YLVNKPSEERVMEIIVDAVKIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLGELGFS
KIFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDADF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcgacccggaaaggccggaagcggccaggccggaggagggtgagcaattgtgtcca
gagacaaaagaaaacgaggtgaggtcaaatgaagagccactcctcagaaagagttcccga
cggtttgtcatctttccaatccagtaccctgatatttggaagatgtataagcaagcacag
gcatctttctggacagcagaggaggttgacttgtccaaggacctccctcattggaacaag
cttaagtcggaagagaagtattttatctcccacatcttagcatttttcgcagccagcgat
ggaattgtaaatgaaaacttggtggagcgttttagtcaagaggtgcaggttccagaggct
cgctgcttctatggctttcagattctcatcgagaatgttcactcagagatgtacagttta
ctaatagacacttacatcagagatccaaagaagagggaatttttatttaatgcaattgaa
acaatgccgtatgttaagaaaaaagcagattgggctctgcgctggatagcagataggaaa
tctacttttggggaaagagtggtggccttcgctgctgtagaagggattttcttctctgga
tcatttgctgctatattctggctaaagaagagaggcctcatgcctgggctgactttttca
aatgaactgatcagcagggatgaaggacttcactgtgactttgcctgcctgatgtttcag
tacctggtaaacaagccttcagaagaaagggtcatggaaatcattgttgatgctgttaaa
attgagcaggagtttttaacagaagccttgcctgttggcctcattggaatgaactgtgtt
ttgatgaaacaatatattgagtttgtagctgacagattacttggagaacttggattctca
aagatttttcaggcagaaaatccctttgattttatggagaacatttcgttagaagggaaa
acaaatttctttgagaaacgagtttctgagtatcagcgatttgcagtcatggcagaaacc
acagataatgtcttcaccttggatgcagatttctaa

KEGG   Rattus norvegicus (rat): 362720
Entry
362720            CDS       T01003                                 

Gene name
Rrm2
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno00480  Glutathione metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    362720 (Rrm2)
   00240 Pyrimidine metabolism
    362720 (Rrm2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    362720 (Rrm2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    362720 (Rrm2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    362720 (Rrm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    362720 (Rrm2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     362720 (Rrm2)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    362720 (Rrm2)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 362720
NCBI-ProteinID: NP_001020911
RGD: 1598310
Ensembl: ENSRNOG00000054286
UniProt: Q4KLN6
Position
6
AA seq 390 aa
MLSVRAPLATIADQQQLHLSPLKRLSLADKENTPPTLSSARVLASKAARRIFQDSAELES
KAPTKPSIEEEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEAL
KPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLL
IDTYIKDSKEREYLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGS
FASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEQRVKEIITNSVRI
EQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFKVENPFDFMENISLEGKT
NFFEKRVGEYQRMGVMSNSTENSFTLDADF
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgctctcggtccgcgccccgctcgccaccatcgctgaccagcagcagctgcacttgtcg
cccctgaagcgactcagtctggctgacaaggagaacacgcccccaaccctcagcagcgcc
cgcgtcctggctagcaaggctgcaaggagaatcttccaggactctgccgagctggaaagt
aaagcacccactaagcccagcattgaggaagagccgttactgagagaaaatccccgccgt
ttcgttgtctttcccatcgaataccatgatatctggcagatgtacaagaaagctgaggcc
tccttttggactgccgaggaggtggacctttccaaggatattcagcactgggaagctctg
aaaccagatgagagacattttatatctcatgttctggccttctttgcggcgagtgacggc
atagtcaatgagaacttggtggagcgatttagccaagaagttcaagtcacagaggcccgc
tgtttctatggcttccaaattgccatggagaacatacactccgaaatgtacagtctcctt
attgacacttacattaaagattccaaagaaagagaatatctcttcaacgccattgagaca
atgccttgtgtgaagaagaaggctgactgggccttgcgttggattggggacaaagaggct
acgtatggagaacgagttgtggccttcgctgcggtagaaggaatcttcttttctggttct
tttgcatcaatattctggctcaagaaacggggactgatgccgggccttacattttccaat
gagcttattagcagagatgagggtctgcactgtgactttgcctgcctgatgttcaagcac
ctggtacacaagccctcggagcagagagtaaaagaaataattaccaactcggtcaggata
gagcaggagttcctcacagaggccctgcctgtgaagctcatcgggatgaattgcaccttg
atgaagcagtacatcgagtttgtggccgacaggcttatgctggagctgggttttaacaag
attttcaaagtagaaaatccatttgacttcatggagaatatttcactagaaggaaaaaca
aacttctttgagaagcgagtaggcgagtaccagaggatgggagtaatgtcaaattcgaca
gaaaattctttcaccttggatgctgacttctaa

KEGG   Rattus norvegicus (rat): 685579
Entry
685579            CDS       T01003                                 

Gene name
Rrm1
Definition
(RefSeq) ribonucleoside-diphosphate reductase large subunit
  KO
K10807  ribonucleoside-diphosphate reductase subunit M1 [EC:1.17.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno00480  Glutathione metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    685579 (Rrm1)
   00240 Pyrimidine metabolism
    685579 (Rrm1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    685579 (Rrm1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    685579 (Rrm1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    685579 (Rrm1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     685579 (Rrm1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    685579 (Rrm1)
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN ATP-cone
Other DBs
NCBI-GeneID: 685579
NCBI-ProteinID: NP_001013254
RGD: 1592569
Ensembl: ENSRNOG00000045752
Vega: OTTRNOG00000002205
UniProt: Q5U2Q5
Position
1
AA seq 792 aa
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA
AETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGRHSPMVASST
LEIVMAHKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHK
EDIDAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL
ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIY
LEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLD
EVWGEEFEKLYESYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL
GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTPEHTYDFEKLAEVTKVIVRNLNKI
IDINYYPIPEAHLSNKRHRPIGIGVQGLADAFILMRYPFESPEAQLLNKQIFETIYYGAL
EASCDLAKEYGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKLLKEKIAKYGIRNSLLIA
PMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWNEEMKNQII
ACNGSIQSIPEIPEDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKALKEEEEKERNTAAMVCS
LENREECLMCGS
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgcatgtgatcaagcgagatggccgccaagagcgagttatgtttgacaaaattacatcc
cgaatccagaaactctgttatggactcaatatggactttgtggatcctgctcagatcacc
atgaaagtaatccaaggcctatacagtggggtcaccacagtggaactggacaccctggct
gctgagacagctgccaccttgactacgaagcaccctgactatgccatcctggcagcaagg
atcgctgtctctaacttgcacaaggaaacaaagaaagtgttcagtgacgtgatggaggat
ctctacaactacataaatccacacaacggcagacattctcccatggtggccagctcaaca
ctcgagattgttatggcccataaggatcgcctgaattctgccattatctatgaccgggat
ttctcttacaactactttggttttaagacactggaacggtcatatttgttgaagatcaat
ggaaaagtggctgaaagaccacagcacatgttgatgagggtatctgtggggattcacaaa
gaagatattgatgctgcaattgaaacatacaatctactttctgagaagtggtttactcac
gcctctccgactctcttcaatgctgggaccaaccgcccacagttgtccagctgtttcctc
ttgagtatgaaagatgacagcattgaggggatttatgatactctgaagcagtgtgccttg
atttctaagtctgctggaggaattggtgttgccgtgagttgtattcgggccactggcagc
tacattgctgggactaatggcaattctaatggccttgtgccaatgctgagagtctataac
aacacagctcgttatgtggatcaaggtggaaacaagcgcccaggggcatttgctatttac
ctggagccttggcacctggacatctttgagtttcttgacttgaagaagaacacaggcaag
gaagaacagcgcgcgcgggatctcttctttgcactgtggatcccagatctcttcatgaag
cgagtggagaccaaccaggactggtcactgatgtgtcccaatgagtgtcctggtctggac
gaggtctggggagaggagtttgagaagttatatgaaagttacgagaagcagggccgtgtc
cgaaaagttgtgaaggctcagcagctttggtacgccatcattgagtctcagacggagacg
ggcaccccatacatgctctacaaagactcctgtaaccggaagagcaaccagcagaacctg
ggaaccatcaagtgcagcaacctgtgcacagagatagtagagtacaccagtaaagatgag
gttgcggtttgtaacttggcttctctggctctgaacatgtatgtcacaccagaacacacg
tatgactttgagaaactggcagaagtcactaaagtcattgtccgaaatctgaataaaata
attgatataaactactatcctattccagaggcacacttatcaaataaacgccatcggccc
attggaattggggtacaaggtctagcagatgctttcatcctgatgaggtatccctttgag
agcccagaagcccagctactaaataagcaaatctttgaaaccatctattatggagccctg
gaagccagctgtgacctagccaaggagtatggcccctacgaaacgtatgagggatctcca
gtcagcaagggtattcttcagtatgatatgtggaatgttactcctacagacctgtgggac
tggaagcttctcaaggagaagattgcaaagtacggtataagaaacagtttacttattgcc
ccaatgcctactgcttcaactgctcagattctggggaataatgagtccattgagccttac
accagtaacatctacactcgcagagtcttgtcaggagaatttcagattgtgaatcctcac
ttactgaaagatcttactgagcggggcttgtggaatgaagagatgaaaaatcagattatt
gcctgcaatggctccattcagagcataccagaaattcctgaggacctgaagcagctctat
aagaccgtgtgggaaatctctcagaagactgttctcaagatggcagccgagagaggtgct
ttcatcgatcaaagccagtctttaaacatccatatcgctgagcccaactatggcaaactc
actagtatgcacttctacggttggaagcagggtttaaagactgggatgtattatttaagg
acaagacctgccgctaatccaatccagttcactctgaacaaggaaaagctgaaagataag
gaaaaggcactgaaggaggaagaagagaaggagaggaacacagcagccatggtgtgctct
ttggagaacagagaggagtgtctgatgtgtggatcctga

DBGET integrated database retrieval system