KEGG   Rattus norvegicus (rat): 300016Help
Entry
300016            CDS       T01003                                 

Gene name
Slurp1, RGD1308768
Definition
(RefSeq) secreted Ly6/Plaur domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: UPAR_LY6 Toxin_TOLIP BAMBI UPAR_LY6_2
Motif
Other DBs
NCBI-GeneID: 300016
NCBI-ProteinID: NP_001124016
RGD: 1308768
Ensembl: ENSRNOG00000005944
Vega: OTTRNOG00000000249
UniProt: D4A7L8
Position
7q34
AA seq 110 aa AA seqDB search
MTLRWAVWLLLLAAWSMGYGEAFRCYTCEQPTAINSCKNIVHCKLEDTACKTVLETVEAE
FPFNHSPMVTRSCSSSCLATDPDGIGVAHPVFCCFRDLCNSGFPGLVTGL
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgacccttcgctgggccgtgtggctgctgctcctggcagcctggagcatgggctatggt
gaggccttcagatgctatacctgtgagcagcccacggccattaactcatgcaagaatatt
gttcactgcaagctggaagacacagcctgtaagactgttttggagacagtggaagcagag
ttccctttcaaccacagtcccatggtgacccgctcctgctccagctcctgcctggccacc
gaccctgatggcattggggttgcccatcctgtcttctgttgcttccgtgatctctgcaac
tcagggtttccaggtttggtgacaggcctctag

DBGET integrated database retrieval system