KEGG   Rattus norvegicus (rat): 300017Help
Entry
300017            CDS       T01003                                 

Gene name
Lypd2
Definition
(RefSeq) Ly6/Plaur domain containing 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: UPAR_LY6 Toxin_TOLIP
Motif
Other DBs
NCBI-GeneID: 300017
NCBI-ProteinID: NP_001124017
RGD: 1307892
Ensembl: ENSRNOG00000006058
Vega: OTTRNOG00000000255
UniProt: D4A707
Position
7q34
AA seq 127 aa AA seqDB search
MQGTRMVLLALILSTFGELAMALRCYACPDPVSASDCVKITPCHTNETMCKTTLYSREIV
FPFLGDSTVTKSCASKCEPSDVDGIGLTRPVSCCNSDLCNVDGAPSLGGPGGLVLVLPLI
FLLHVLL
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggacccggatggtgctgttggcactgatattgagcaccttcggggaacttgct
atggccttacggtgctatgcctgtccggatcctgtgagtgcgtctgactgcgtcaagatc
acaccctgccacaccaatgaaaccatgtgcaagaccactctctactcccgggagatagtg
tttcctttcctgggggactccacggtgaccaagtcctgtgccagcaagtgcgagccttca
gacgtggatggcattgggctaacccggccagtgtcctgctgcaattctgacctatgcaac
gtggacggggcacccagcctgggcggtcctggtggcctggtccttgtcctgccacttatc
tttctactgcatgtcctgctgtaa

DBGET integrated database retrieval system