KEGG   Rattus norvegicus (rat): 300033Help
Entry
300033            CDS       T01003                                 

Gene name
Eef1d
Definition
(RefSeq) eukaryotic translation elongation factor 1 delta
  KO
K15410  elongation factor 1-delta
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    300033 (Eef1d)
Translation factors [BR:rno03012]
 Eukaryotic Type
  Elongation factors
   300033 (Eef1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF1_GNE EF-1_beta_acid JIP_LZII Striatin KASH_CCD Trimer_CC
Motif
Other DBs
NCBI-GeneID: 300033
NCBI-ProteinID: NP_001013122
RGD: 621174
Ensembl: ENSRNOG00000021638
UniProt: Q68FR9
Position
7q34
AA seq 650 aa AA seqDB search
MRSGKASCALETVWEDKHKYEEAERRFHEHEATQAAAASVQQLLAEVPAVNGPSSQEDAE
DTDEAETPNTSSRSDPRKSHECKKPLQKKRKRSPKSWLGQADLALVGLSADHVWLDKPLF
DQAESSYRQRLADVAAQAAQSPALAPRGPCTHGSHVACHHVTWGIWVNKSCFDQAERAFV
EWSQALLLAAEGSHREGTPDTGQQAVTPDLALACQPCPPANGQPPLGSLQALVREVWLEK
PRYDAAERGFYEALFDGHPPGKVRLQERASQAEGTRRGRRDRRSRNTVGNKRAGSKRADG
EAPSALPYWYFLHKDAEAPWLSKPTYDSAECRHHAAEALRIAWRLEAASLAHRPTPRSGP
SMSSLRPKKMATNFLMHEKIWFDKFKYDDAERRFYEQMNGPVTAGSRQENGASVILRDIA
RARENIQKSLAGSSGPGASSGPGGDHSDLIVRIASLEVENQNLRGVVQDLQQAISKLEVR
LSTLEKSSPTHRATAPQTQHVSPMRQVEPPAKKGATPAEDDEDNDIDLFGSDEEEEDKEA
ARLREERLRQYAEKKAKKPTLVAKSSILLDVKPWDDETDMAQLETCVRSIQLDGLVWGAS
KLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgaggagtgggaaggcctcttgtgcgctggagaccgtctgggaggacaagcacaagtat
gaggaagccgagcggcgcttccacgagcatgaggccacacaagccgccgccgcctctgtc
cagcagctcctggccgaagtgccagctgtgaacgggcccagcagccaggaggacgcggag
gacaccgacgaggcagaaacccccaacaccagcagcaggagtgatcctaggaagagccac
gagtgcaagaagccgttacagaaaaagaggaagcgctccccgaagagttggcttggccag
gcggacctggcccttgtgggcctctcagctgaccacgtatggttggacaagccactcttt
gaccaggcagaaagctcctaccgccagaggctggcagatgtagctgcccaggcagcccag
tcgcctgccctggcccctcgagggccctgtacacatggaagccatgtggcgtgccaccat
gtgacctgggggatctgggtcaacaagtcttgctttgatcaagctgagcgggcttttgtg
gagtggtctcaggccttgctgctggctgcagaggggagccatagggaggggactcctgac
acaggccagcaggctgtcactcctgacctggccttggcctgccagccttgtccaccagcc
aatggccagcctcctctgggcagcctgcaggcactggtgagggaggtatggctggaaaag
ccccgttatgatgcagctgaaaggggcttctatgaggccctatttgatggccacccccca
gggaaagtgcgcctgcaggagcgagccagtcaggcggagggtactcggaggggccgcaga
gaccgtcggagccgcaatactgtaggaaacaagcgagctgggtcaaaacgggccgatggg
gaggctccttctgccttgccctactggtacttcctgcacaaggacgcagaggccccctgg
cttagcaagccgacctacgacagcgccgagtgtcgccaccatgccgccgaggccctgcgg
attgcctggcgcctagaagctgcctcactggctcaccgacccacgccccgttctggccca
tccatgtccagcctgagacccaaaaaaatggctacaaactttctcatgcacgagaaaatc
tggtttgacaagtttaaatatgacgatgcagaaaggagattctacgagcagatgaatggg
cctgtgaccgctggctctcggcaggagaatggcgccagcgtgatcctccgagacattgca
agagccagagagaacatccagaaatccttggctggaagttcaggccctggagcctccagt
ggacctggtggagaccacagtgacctcattgtgcggattgccagtctggaagtagagaac
cagaaccttcgaggcgtggtgcaagatttgcagcaggccatttccaagttggaggtccgg
ctgagcactctggagaagagttcacctactcaccgagctacagccccacagacccaacat
gtctctcctatgcgtcaagtggagcccccagccaagaaaggagccacaccagcagaggac
gacgaggacaatgacattgacctgttcggcagtgatgaggaagaggaagataaggaggct
gcccgactacgggaagagaggctacgccagtacgcagagaagaaggccaagaagcccaca
ctggtggccaaatcctccatcctcttggatgttaaaccttgggatgatgagacagacatg
gcccagctagagacttgtgtgcgttccatccaattggacggactggtttggggggcctcc
aagctcgtgcctgtcggctatggtatccggaagctgcagatccagtgtgtggtagaggat
gacaaagtgggcaccgacttgctcgaagaggagatcaccaagtttgaggagcatgtgcag
agtgtcgacattgcagccttcaacaagatctga

DBGET integrated database retrieval system