KEGG   Rattus norvegicus (rat): 300047
Entry
300047            CDS       T01003                                 

Gene name
Cyc1
Definition
(RefSeq) cytochrome c-1
  KO
K00413  ubiquinol-cytochrome c reductase cytochrome c1 subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Module
rno_M00151  Cytochrome bc1 complex respiratory unit
rno_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    300047 (Cyc1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    300047 (Cyc1)
  09159 Environmental adaptation
   04714 Thermogenesis
    300047 (Cyc1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    300047 (Cyc1)
   05012 Parkinson disease
    300047 (Cyc1)
   05014 Amyotrophic lateral sclerosis
    300047 (Cyc1)
   05016 Huntington disease
    300047 (Cyc1)
   05020 Prion disease
    300047 (Cyc1)
   05022 Pathways of neurodegeneration - multiple diseases
    300047 (Cyc1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    300047 (Cyc1)
SSDB
Motif
Pfam: Cytochrom_C1 Cytochrome_CBB3 Cytochrom_C
Other DBs
NCBI-GeneID: 300047
NCBI-ProteinID: NP_001264123
RGD: 1306597
Ensembl: ENSRNOG00000012457
UniProt: D3ZFQ8
Position
7q34
AA seq 326 aa
MAAAAAASLRRSVLGPRGMGLPGASAPGLLGGARPRHLPLRTPQAVSLSSKSGPSRGRKV
MLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQ
VCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNEDGNMFMRPGKLSDYFPKPY
PNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPG
QAIGMAPPIYTEVLEYDDGTPATMSQVAKDVATFLRWASEPEHDHRKRMGLKMLLMMGLL
LPLTYAMKRHKWSVLKSRKLAYRPPK
NT seq 981 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcttcgcttcgccgatcggtgctaggcccgcggggcatgggg
cttccaggtgcaagtgctccgggcctgctgggcggcgcgcggccccggcatcttccatta
cggacaccgcaggcagtgtccttgtcctcgaagtctggcccttctcgaggccgaaaggtg
atgctgtcagcgttgggcatgctggcagcagggggtgcagggctagctgtggcccttcat
tcggcggtgagtgccagtgacctggagctgcacccccccagctacccatggtctcaccgt
ggcctcctctcctccttggaccacaccagcattcgtaggggtttccaggtatacaagcag
gtgtgctcttcctgccacagcatggattatgtggcttaccgccacctggtgggagtgtgc
tacacggaggaagaagctaaggcgctggctgaggaggtggaggtccaggatggccctaat
gaggatgggaatatgttcatgcggccagggaagctgtctgactattttccaaaaccatac
cccaaccctgaggctgcaagagctgctaacaatggagctttaccccctgacctcagctac
atcgttcgagcaaggcacggtggtgaggactatgtgttttccttgctcactggctactgt
gaacctcccactggggtgtcattgcgagaaggcctctatttcaacccttactttcctggc
caggccattggcatggctcctcccatctacacagaagtcttggagtatgacgatggtacc
ccagctaccatgtcacaagtagccaaggatgttgccaccttccttcgctgggcatcagag
ccagagcatgaccatcgaaaacgcatgggactcaagatgttgttgatgatgggcttgctg
ctgcccctgacctatgccatgaagcggcataagtggtcagtcctgaagagtcgaaagctg
gcttatcggccacccaagtga

DBGET integrated database retrieval system