KEGG   Rattus norvegicus (rat): 300052Help
Entry
300052            CDS       T01003                                 

Gene name
Vps28
Definition
(RefSeq) VPS28, ESCRT-I subunit
  KO
K12184  ESCRT-I complex subunit VPS28
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    300052 (Vps28)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    300052 (Vps28)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    300052 (Vps28)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    300052 (Vps28)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   300052 (Vps28)
  Exosomal proteins of other body fluids (saliva and urine)
   300052 (Vps28)
  Exosomal proteins of colorectal cancer cells
   300052 (Vps28)
  Exosomal proteins of bladder cancer cells
   300052 (Vps28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VPS28 RIG-I_C
Motif
Other DBs
NCBI-GeneID: 300052
NCBI-ProteinID: NP_001123964
RGD: 1306537
Ensembl: ENSRNOG00000014633
UniProt: A0A0H2UHM0
Position
7q34
AA seq 221 aa AA seqDB search
MFHGIPATPGVGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTV
SQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtttcacgggatcccagctactcctggtgttggagcccctgggaacaagccggagcta
tacgaggaagtaaagttgtacaagaatgcccgggagcgggagaagtatgacaacatggcg
gagctctttgcggtggtgaaaacgatgcaagcgctggagaaggcatacatcaaggactgc
gtcacccccaatgagtacactgcagcctgctccaggctcctggtccagtacaaagctgcc
ttccggcaggtccaaggctcagagatcagctccattgatgaattttgccgaaagttcaga
ctggactgcccacttgctatggagcggatcaaagaggaccgacccatcaccatcaaggac
gacaagggcaatctcaaccgctgtattgcggacgtcgtctcgctcttcattacagtcatg
gacaagctgcgtctggagatccgcgccatggacgagatccagccagacctgcgggagcta
atggagaccatgcacagaatgagccacctgcctccagactttgagggccgccaaacagtc
agccagtggctgcagaccctgagtggtatgtcggcctctgatgagctagatgactcccaa
gttcgccagatgctcttcgatctggagtcagcttacaatgccttcaaccgcttcctacac
tcctga

DBGET integrated database retrieval system