KEGG   Rattus norvegicus (rat): 300075Help
Entry
300075            CDS       T01003                                 

Gene name
Tomm22, TOM22, rTOM22
Definition
(RefSeq) translocase of outer mitochondrial membrane 22
  KO
K17769  mitochondrial import receptor subunit TOM22
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    300075 (Tomm22)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    300075 (Tomm22)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    300075 (Tomm22)
Transporters [BR:rno02000]
 Other Transporters
  Primary active transporters [TC:3]
   300075 (Tomm22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tom22
Motif
Other DBs
NCBI-GeneID: 300075
NCBI-ProteinID: NP_997679
RGD: 1303260
Ensembl: ENSRNOG00000014058
Vega: OTTRNOG00000000738
UniProt: Q75Q41
Position
7q34
AA seq 142 aa AA seqDB search
MAAAVAAAGAGEPLSPEELVPKAEAEKAEEDLEEDDDDELDETLSERLWGLTEMFPERVR
SAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQIL
LGPNTGLSGGMPGALPPLPGKI
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccgtcgctgcagccggcgctggggagcctctgtcccccgaagaattggtc
ccgaaagccgaggcagagaaagctgaggaggacctggaagaagacgacgacgacgagcta
gatgagaccctatcggagagactctggggtctgacggagatgtttcccgagagggtccgg
tcagccgctggagccacctttgatctctcgctcttcgtggctcagaagatgtacagattt
tccagggcagctttgtggattgggaccacttccttcatgatcctggttcttcctgttgtc
tttgagacagaaaagttgcaaatggagcaacaacagcaactgcagcaaaggcagatactt
ttagggcctaacacaggactgtcaggaggaatgccaggggctctacctccacttcctgga
aagatctag

DBGET integrated database retrieval system