KEGG   Rattus norvegicus (rat): 300079
Entry
300079            CDS       T01003                                 

Gene name
Rpl3
Definition
(RefSeq) ribosomal protein L3
  KO
K02925  large subunit ribosomal protein L3e
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    300079 (Rpl3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    300079 (Rpl3)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    300079 (Rpl3)
SSDB
Motif
Pfam: Ribosomal_L3 DUF3903
Other DBs
NCBI-GeneID: 300079
NCBI-ProteinID: NP_942048
RGD: 735105
Ensembl: ENSRNOG00000016896
Vega: OTTRNOG00000002109
UniProt: P21531
Position
7q34
AA seq 403 aa
MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREV
DRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYK
NWHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQVIRIIAHTQMRLLPLRQKKAHL
MEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKL
PRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIK
NNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLVQTKRRAL
EKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAKEEGA
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgtctcacaggaaattctcagctcctaggcatgggtccttgggcttcttgcctcggaag
cgcagcagccggcatcgtggaaaagtgaagagcttccctaaggatgacccttccaagcct
gttcacctcacagccttcctagggtacaaggctggcatgacccacattgtccgggaagtt
gaccggccaggatctaaggtgaataagaaagaagttgtggaggctgtgaccattgtggaa
accccacccatggtggttgtgggtattgtgggatatgtagaaaccccacgaggcctccgg
accttcaagactgtatttgctgagcacatcagcgatgagtgtaaaaggcgtttctataag
aattggcacaaatctaagaagaaggcttttaccaagtactgtaagaaatggcaagatgac
acaggcaagaagcagctggagaaggacttcaacagcatgaagaagtactgccaggtcatc
cgcataattgctcacactcagatgcgcctgcttcctctgcgccagaagaaggcacacttg
atggagatccaggtgaatgggggcactgtagctgagaagctagactgggcccgagagagg
ctggagcagcaggtccctgtgaaccaggtgtttgggcaagatgagatgattgacgtcatc
ggcgtgacaaagggcaaaggctacaaaggggtgaccagtcgttggcatacaaagaagctg
ccccgaaagacccacagaggtctgcgcaaagttgcttgtattggagcttggcatcctgcc
cgtgtagccttctctgtggctcgagctgggcagaaaggctaccatcaccgaacagagatc
aacaagaagatttacaagattggtcaaggctacctcatcaaggatggtaagctgatcaag
aacaatgcatctactgactacgacctgtctgacaagagcatcaacccactgggtggcttt
gtccattatggtgaggtgaccaatgacttcatcatgctcaaaggctgtgtggtgggaacc
aagaagcgagtgcttactctccggaagtccttgctggtccagaccaagcgtcgggctctt
gagaagattgacctgaagttcattgacaccacctccaaattcggacatggtcgcttccag
accatggaggaaaagaaagcattcatgggaccgctcaagaaagatcgcattgccaaggag
gaaggtgcctga

DBGET integrated database retrieval system