KEGG   Rattus norvegicus (rat): 300088
Entry
300088            CDS       T01003                                 

Gene name
Polr3h
Definition
(RefSeq) DNA-directed RNA polymerase III subunit RPC8
  KO
K03022  DNA-directed RNA polymerase III subunit RPC8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    300088 (Polr3h)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    300088 (Polr3h)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    300088 (Polr3h)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     300088 (Polr3h)
SSDB
Motif
Pfam: RNA_pol_Rbc25 SHS2_Rpb7-N
Other DBs
NCBI-GeneID: 300088
NCBI-ProteinID: NP_001120767
RGD: 1305889
Ensembl: ENSRNOG00000004471
UniProt: B2RZB0
Position
7
AA seq 204 aa
MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVF
PGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKF
DEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSAEAASSSEELPKK
EAPYTLVGSISEPGLGLLSWWTSN
NT seq 615 nt   +upstreamnt  +downstreamnt
atgttcgtgctggtggagatggtggacaccgtgcgcatacccccgtggcagtttgagcgg
aaactcaacgactccattgctgaggagctgaacaagaaattggccaacaaggtcgtatac
aatgtgggactctgcatctgtctgtttgatatcaccaagctggaggatgcctacgtattc
ccaggggatggagcatcacataccaaagtgcatttccgatacgtggtgttccaccctttc
ctggatgagattctcattgggaagatcaaaggctgcagcccagagggtgtgcacgtctct
ttagggttctttgatgacatcctcatcccccctgagtcactgcagcagcctgccaagttt
gatgaagcggagcaagtgtgggtgtgggagtatgagaccgaggaaggagctcatgacctg
tacatggacactggtgaggagatccgcttcagggtggtggatgagagttttgtggacaca
tcccccacaggacccagctcagccgaggctgcctcttcaagcgaggagctgccaaagaag
gaagcaccatatacactcgtgggatccatcagtgagccaggcctgggccttctctcctgg
tggaccagcaactag

DBGET integrated database retrieval system