KEGG   Rattus norvegicus (rat): 300095Help
Entry
300095            CDS       T01003                                 

Gene name
Srebf2, SREBP-2, SREBP2, Srebf2_retired
Definition
(RefSeq) sterol regulatory element binding transcription factor 2
  KO
K09107  sterol regulatory element-binding transcription factor 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    300095 (Srebf2)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    300095 (Srebf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 300095
NCBI-ProteinID: NP_001028866
RGD: 1307751
Ensembl: ENSRNOG00000007400
UniProt: Q3T1I5
Position
7q34
AA seq 1133 aa AA seqDB search
MDENSELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFSDLFSEQLCSSFPGGGGG
SGSGGTSNNSSGRGTSGGAADPAVQRSFSQVPLSTFSPSSTSPQAPALQVKVSPTPPRAT
PVLQPRPQPQPQPPAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQVLQPQVQSL
VTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVATPQVQQVPVLVQPQII
KTDSLVLTTLKTDGSPVMAAVQNPALTALTAPIQTAALQVPTLVGSNGAILTTMPVMMGQ
EKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHKSG
VLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDSDVDLKIDDFNQNV
LLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILLCVLT
FLGLSFNPLTSLLQWGGAHNPDQHPYSGSGRNVLSLESGSGGWFDWMMPTLLLWLLNGVI
VLSVFVKLLVHGEPVIRPHSRSSVTFWRHRKQADLDLAKGDFAAAAANLQTCLSVLGRAL
PTSRLDLACSLSWNVIRYSLQKLRLVRWLLKKVFQRWRATPATAAGFEDEAKSSARDAAL
AYHRLHQLHITGKLPAGSACSDVHMALCAVNLAECAEEKIPPSTLVEIHLTAAMGLKTRC
GGKLGFLASYFLNRAQSLCGPEHSAVPDSLRWLCHPLGQKFFMERSWSIKSAAKDSLYCA
QRNPADPIAQVHQAFCKHLLERAVEALVKPQAKKKAGDREEESCEFSSALEFLKLLHSFV
DSVGFVASPFSSSSVLRSALGPDVVCRWWTSAITVAISWLQGDDAAVRSHFTEVERVPKA
LEVTESPLVKAVFYACRAMHASLSGKADGQQNSFCHCERASGHLWSSLNVSGTTSDPSLN
HVVQLLTCDLLLSLRTTLWQKQASASQLLGETYHASGTELAGFQRDLGSLRRLAHSFRPA
YRKVFLHEATVRLMAGASPTRTHQLLEHSLRRRTTQNTKHGEVDTWPGQRERATAILLAC
RHLPLSFLSSPGQRAVLLAEAARTLEKVGDRRSCSDCQQMIVKLGGGTAIAAS
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
atggatgagaacagcgagctgggcggtctggagaccatggagaccctcacggagctgggc
gatgagctgactctcggggacatcgacgagatgctacagtttgtcagcaatcaagtggga
gagttctctgacttgttttcagagcaactatgtagctccttccctggaggtggtggcggc
agtggcagtggtggcaccagcaacaacagcagtggcagaggcaccagtggtggagctgca
gatcccgcagtacagcggtcattcagccaggtcccattgtctaccttctctccctcatcc
acctcccctcaggctccagccctgcaggtcaaagtctctcctaccccaccaagggcaacc
cctgttctccagccccgaccccagccccagcctcaacctccagctcagctgcagcagcag
acggtgatgatcaccccgaccttcagcaccgctccacagaccaggatcatccagcagcct
ttgatataccagaatgccgcaaccagctttcaagtcctgcagcctcaagtgcaaagcctc
gtgacatcctcgcaggtacagccagttaccatccagcagcaggtgcagacggtacaggcc
cagcgggtgttgactcagacagccaatggcacactgcagacccttgccccagccacagtg
cagacagtcgctacaccacaggtgcagcaggtcccggtcctggttcagcctcagattatt
aagacagattcccttgttttgaccacgctgaaaacagatggcagccctgtcatggccgcc
gtccagaacccggccctcactgccctcaccgcccccatccagacggccgcccttcaagta
ccaaccctggtgggcagcaacggggccattctgaccacaatgccggtaatgatgggccaa
gagaaagtccccattaagcaagtgcctgggggtgtaaagcagctcgagcctcccaaagaa
ggagagaggcggacaacacacaatatcattgagaagcggtaccggtcctccatcaacgac
aaaatcatagagttgaaagacttggtcatggggacagatgccaagatgcacaagtctggc
gttctgaggaaggccattgattacatcaagtacctgcagcaggtcaaccacaagctgcgc
caggagaacatggtgctgaagctggcaaatcagaaaaacaagctcctgaagggcatcgac
ttgggcagtctggtggacagtgatgtggacttgaagatcgatgacttcaatcagaatgtc
cttctgatgtctcccccggcctcggactccgggtcccaggctggcttctccccctattcc
attgactctgagccgggcagccctctgctggatgatgcaaaggtcaaggatgaaccggac
tctccccctgtggcactgggcatggtggaccgatctcgaattctcttatgtgtcctcacc
ttcctgggtctctcctttaaccccttgacttcattgctgcagtggggaggggcccacaac
cctgaccaacacccgtactcaggctctggccgcaatgtactgtcactggagtcaggttct
ggaggctggtttgactggatgatgccgactctactgctgtggctgctaaacggtgtgatt
gtcttgagcgtcttcgtgaagctgttggtccatggggagccagtgatccgcccacactca
cgctcctcggtcaccttctggagacaccggaagcaggcagacctagacctcgccaaaggt
gactttgcagctgctgctgccaacctacagacctgcttatccgttttgggccgggcgctg
cccacctcccgcctggacttggcctgcagcctctcctggaacgtgatccgctacagcctg
cagaagctgcgcctggtacgctggttactcaaaaaggtcttccagcgctggcgggctacc
cccgccactgcagccggctttgaggatgaagctaagagcagtgcgagggatgcggccctg
gcctaccacaggctgcaccagctgcacatcacagggaagcttccagcaggatctgcctgt
tccgatgtgcacatggctctgtgtgctgtgaacctcgccgagtgtgcagaggagaaaatc
ccaccaagcacacttgtcgagatccacctgaccgctgccatggggctcaagacccgatgc
gggggcaagctgggcttcttggctagctacttcttaaatcgtgcccagagtctgtgtggc
ccagagcatagcgctgtccccgactccctgcgctggctgtgccatcccctgggccagaag
tttttcatggagcgaagctggtcgatcaagtcagcagccaaggacagcctgtactgcgcc
cagaggaacccagctgaccccattgcccaggtacaccaggctttctgcaaacacctgctg
gaaagagctgtggaggccttggtgaagcctcaggccaagaagaaggcaggtgaccgggaa
gaagagagctgtgaattttccagtgctctagagtttttgaaattacttcactcttttgtg
gactctgtgggatttgtggcctcaccattctccagcagttctgtgctcaggtcagccctt
ggtcccgatgtcgtctgtcggtggtggacgtccgcgatcaccgtggccatcagctggctc
cagggcgatgatgcagctgtgcgctcgcatttcactgaagtagagcgggtccccaaggcc
ctggaagtgactgagagtcccttggtgaaggccgtcttctatgcctgtagagccatgcat
gcctcactctctggaaaggccgatgggcaacagaactccttctgtcattgtgagagggcc
agtggtcacctgtggagcagtctcaatgtcagcggcactacttctgacccttcacttaac
catgtggtccagctgctcacctgtgatctgctactgtcactgaggacaacactctggcaa
aagcaggccagcgccagccagctcctgggcgagacctaccacgcgtcaggcactgagctg
gccggcttccagcgggacctgggcagccttcgaaggctggcccacagtttccgcccagca
taccgcaaggtgttcctgcatgaagcaactgttcgactaatggcgggagccagccccacc
cgtacacaccagctgctggagcacagcctacggcgccgcaccactcagaacaccaaacac
ggagaagtagacacctggcctggccagcgagaacgagccactgccatcctgctggcctgc
cgccatcttcccctctccttcctatcttccccgggccagcgggcagtgctgctggctgaa
gctgcccgcaccctggagaaggtgggtgaccgccgttcctgcagtgactgccagcagatg
attgtcaagctgggcggtggcactgccatcgctgcttcctga

DBGET integrated database retrieval system