KEGG   Rattus norvegicus (rat): 300105Help
Entry
300105            CDS       T01003                                 

Gene name
Ttll12, RGD1305319
Definition
(RefSeq) tubulin tyrosine ligase like 12
  KO
K16609  tubulin--tyrosine ligase-like protein 12
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    300105 (Ttll12)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Tubulin modification proteins
     Other tubulin modification proteins
      300105 (Ttll12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TTL
Motif
Other DBs
NCBI-GeneID: 300105
NCBI-ProteinID: NP_001129394
RGD: 1305319
Ensembl: ENSRNOG00000022623
UniProt: D4A1Q9
Position
7q34
AA seq 639 aa AA seqDB search
MEGEPRSQPGSPGRAERLNARLLDEFVSLHGPALRASGVPERLWGSLLHKLEHEVFDAGE
MFGIMQVEEVEEAEDEAAREAQRKQPNPGGELCYKVIVTSENGVRADDPNSIFLIDHAWT
CRVEHARKQLQQVPGLLHRMANLMGIEFHGEVPSPEVVALVLEEMWKFNQTYQLAHGTAE
EKVPVWYIMDEFGSRIQHADMPSFATAPFFYMPQQVAYTLLWPLRDLDTGEEVTRDYAYG
EADPLIRKCMLLPWAPADMLDLSSSTPEPPAKYYQAILEENKEKLPLTISPVARPQGHIF
RVHCDVQQVLSHLTHPRFTFTDSEADADVYFHFSHFKDYTKLSQESPQVLLNQFPCENLL
TVKDCLASIARRAGGPEGPPWLPRTFNLRTELPQFVSYFQHRERRGEDNHWICKPWNLAR
SLDTHVTNNLHSIIRHRESTPKVVSKYIESPVLFFREDVGNVKFDIRYIVLLRSVRPLRL
FVYDVFWLRFSNRPFALNDLDDYEKHFTVMNYDPDVVLKQVHYNEFIPQFEKQNPEFPWS
GVQAEIFKAFTELFEVACAKPPPMGLCDYPSSRAIYAIDLMLKWDSHPDGKRVMQPQILE
VNFNPDCERACKYHPSFFNDVFSTLFLDETDDCHVTRII
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgaaccccggtcgcagcctggcagcccgggccgcgccgagaggctgaacgcg
cggctgctggacgagttcgtgtcgctacacggacccgcgctacgcgcctcaggcgtccca
gagcgactatggggcagcctcctgcacaagctggagcacgaggttttcgatgctggggag
atgtttgggataatgcaagtggaggaggtggaggaggctgaggacgaggccgccagggag
gctcagagaaagcagccgaatcctgggggcgagctgtgctacaaggtcattgtgaccagt
gagaacggcgtccgggctgatgaccccaacagcatcttcctcatcgaccatgcctggacg
tgccgtgtggagcatgcacgcaaacagctgcagcaggtgcctggactcctacaccggatg
gccaacctcatgggcatcgagttccatggcgaagtgcccagtccagaggttgtggcccta
gtgctggaggagatgtggaaattcaaccagacctatcagctggcccatgggacagccgaa
gagaaggtgccagtgtggtacatcatggacgagtttggctcaaggatccagcatgcagac
atgcccagcttcgccactgctcccttcttctacatgccccagcaggtggcatacacgctg
ctgtggcccctaagggacctagacacaggcgaggaggtgacccgggactatgcctacgga
gaggcagaccctctgatccggaaatgcatgctgctgccctgggcccccgccgacatgctg
gacctcagctcctctacgcctgagcctcccgccaagtactaccaggccattttggaggaa
aacaaggagaaactgccactcaccattagcccggtggcacgtccccagggccacatcttc
agagtccactgcgatgtgcaacaggtgctcagccacctcacgcaccctcgcttcaccttc
actgacagcgaggccgacgccgacgtctacttccatttctcgcacttcaaggactacacg
aaactcagccaagagagcccacaggtactactcaaccagttcccctgtgagaacctgctg
actgttaaggactgtctggcctccatcgctcgccgggctggaggtcctgagggtcccccc
tggctaccccgaaccttcaacctgcgcaccgagctgccccagttcgtcagctatttccag
caccgagagaggcggggtgaagacaaccactggatctgcaagccttggaacctggcccgc
agcctggacactcacgtcaccaacaatctccacagcatcatccgacaccgagagagcacc
cccaaggttgtgtcaaaatacattgaaagtcccgtcttgttcttccgagaagacgtgggg
aacgtcaagtttgacatccgctacattgtgctgctgcgctcagtgaggccgctgaggttg
tttgtgtatgatgtgttctggctacgcttctccaatcggcctttcgccctcaatgaccta
gacgactatgagaagcatttcaccgtcatgaactatgacccggatgtggtgctaaagcag
gtgcactataatgagttcatcccccagtttgagaagcagaacccagagtttccttggagt
ggtgtccaggctgagatcttcaaggccttcacggagctgtttgaagtggcatgtgccaag
ccaccccccatgggtctctgcgactacccctcatctcgggccatatatgctattgacctc
atgctcaagtgggacagccatccagatggaaagcgggtgatgcagccccagatcctggag
gtgaacttcaaccctgactgcgagcgagcctgcaagtaccacccctcgttcttcaacgat
gtcttcagcaccttgtttctggacgagaccgacgactgccatgtcacccgcatcatctag

DBGET integrated database retrieval system