KEGG   Rattus norvegicus (rat): 300108
Entry
300108            CDS       T01003                                 

Gene name
Pnpla5, RGD1307495
Definition
(RefSeq) patatin-like phospholipase domain containing 5
  KO
K16814  patatin-like phospholipase domain-containing protein 5 [EC:3.1.1.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    300108 (Pnpla5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     300108 (Pnpla5)
SSDB
Motif
Pfam: Patatin
Other DBs
NCBI-GeneID: 300108
NCBI-ProteinID: NP_001123969
RGD: 1307495
Ensembl: ENSRNOG00000022296
UniProt: D3ZXU1
Position
7q34
AA seq 453 aa
MLQRSTKAEESAVPRPKRPIMDFLEVEGGWSLSFSGSGYLGLYHVGATECLRQRAPRLIQ
GARRFYGSSSGALNALSIICGKSADFTCSNLLAMVKHVERLSLGIFHPAYGPIEHIKKKL
QDDLPDNSHIVASQRLGISLTRWPDGQNFIVTDFATRDELIQALVCTLYFPFYCGTIPPA
FRGERFIDGALSNNLPFSNCPTTITVSPFNGTVDICPQSTSSSLFELTAFNASFQISTRN
FFLGFKSLFPPKPEVVADYCRQGYLDALRFLERRGLTKEPVLWSLVSKEPPALVEGPRGT
DHNQGQEAGLIVRWDIPNVLVKDVPNFELLSPELEAALKKACKRDFWAQIQCSVPGKVLT
YLLLPCTLPFEYAYFRSRRLMQWLPEVPDDLYWMQGLLKTTTLKVYSMAKSWLLSLGSPL
VTSADAGLLWQQQGTAAAGNRPLNHRLADCALG
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgctccagcgcagcaccaaggctgaggagtctgcagtcccgcgtcccaagcgcccaatt
atggacttcctggaggtagagggcggttggagcctgtccttctcaggctctggctacctg
ggcctctaccacgtgggtgccaccgagtgtctgcgccagcgcgcgccgcgcctcatccag
ggtgcccgccgtttctacggctcttcctcgggcgcgctcaacgccctgagcatcatctgt
ggcaagtccgcagacttcacctgctccaatctcctggccatggtgaaacacgtggagcgg
ctgagcctgggcatcttccatccggcctatggacccattgagcacatcaagaaaaagctg
caagacgacttacccgacaacagccatattgtggcctcccagaggctgggcatctccctg
acccgatggcctgatggtcagaacttcatagtcactgattttgccactcgggatgaactc
atccaggctctggtctgcaccttgtattttcccttttactgtgggacgatacccccggca
ttcagaggggagcgcttcattgacggggccctgagcaacaacctgcccttctccaactgt
cctaccaccatcaccgtctctcctttcaacgggacagtggacatctgtccccagagcacc
tcatccagcctttttgagctaactgccttcaatgccagtttccagatctctaccaggaac
ttctttctggggttcaaatccctgtttccccccaagcctgaggtggtggctgactattgc
agacaaggttacctggatgccctgaggttcttggagagacggggacttaccaaggagcca
gtgctgtggtcgctggtttctaaggagcctccagccctcgtggaggggcccaggggaact
gaccataaccagggtcaggaggctggtctgattgtcaggtgggacatccccaatgtgctg
gtaaaggacgtgcccaacttcgagctgctgtcaccggagctggaggctgcattgaaaaag
gcatgcaagagagacttctgggcccaaatccagtgttcagtgccagggaaggtgctgacc
tacctgcttttgccctgtacgctgccctttgagtatgcctatttccggagcaggaggctg
atgcaatggttgccggaggtgccagatgacttgtattggatgcagggcctactgaagact
accaccctcaaggtctactccatggcgaagtcatggcttctcagcttgggcagcccactt
gtcaccagtgcagacgctggtctcctctggcagcagcaggggacagctgctgctgggaac
aggcccttgaaccacaggttggcggattgtgcactgggctag

DBGET integrated database retrieval system