KEGG   Rattus norvegicus (rat): 300147
Entry
300147            CDS       T01003                                 

Gene name
Sbf1
Definition
(RefSeq) SET binding factor 1
  KO
K18061  myotubularin-related protein 5/13
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    300147 (Sbf1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    300147 (Sbf1)
SSDB
Motif
Pfam: SBF2 Myotub-related DENN GRAM uDENN PH dDENN SPA PH_11 PH_8 PH_2 T2SSJ
Other DBs
NCBI-GeneID: 300147
NCBI-ProteinID: NP_001258102
RGD: 1307090
Ensembl: ENSRNOG00000008392
UniProt: M0RAP5
Position
7q34
AA seq 1893 aa
MARLADYFVLVAFGPHPRGSGEGQGQILQRFPEKDWEDNPFPQGIELFCQPSGWQLCPER
NPPTFFVAVLTDINSERHYCACLTFWEPVESTQEVMCTEDATEKEEEAHGGGQAQLSSTA
PAQPGQLFAPKTLVLVSRLDHADVFRNSLGLIYTIHVEGLNVNLENVIGNLLTCTVPLAG
GSQRTISLGAGDRQVIQTPLVDSLPVSRCSVALLFRQLGITNVLSLFCAALTEHKVLFLS
RSYQRLADACRGLLALLFPLRYSFTYVPILPAQLLEVLSTPTPFIIGVNAAFQAETQELL
DVIVADLDGGTVTVPECVHIPPLPEPLQSQTHNVLSMVLDPELELADLAFPPPTTSASSL
KMQDKELRAVFLRLFAQLLQGYRWCLHIVRIHPEPVIRFHKAAFLGQRGLVEDDFLMKVL
EGMAFAGFVSERGVPYRSTDLFDELVAHEVARMRADENHPHRVLRHVQELAEQLYKNENP
YPAVAMHKVQRPGEASHLRRTHRPFPRLDEGTVQWIVDQAAAKMQGAPPAVKAERRTTVP
SGPPMTAILERCSGPHINSARRLEVVRNCISYVFEGKMLEAKKLLPAVLRALKGRAARRC
LAHELHLHVQQNRAVLDHQQFDFVVRMMNCCLQDCTSLDEHGIAAALLPLVTAFCRKLSP
GVTQFAYSCVQEHVVWSTPQFWEAMFYGDVQTHIRALYLEPSDGVSPTQETGEAQSQDDE
RSALDVASEQRRLWPTLSREKQQELVQKEESTVFSQAIHYANRMSYLLLPLDSSKSRLLR
ERAGLGDLESASNSLVTNSMAGSVAESYDTESGFEDAETCDVAGAVVRFINRFVDKVCTE
SGVTSDHLKGLHVMVPDIVQMHIETLEAVHRESKRLPPIQKPKLLRPRLLPGEECVLDGL
RVYLLPDGREEGVGGSGGGPALLPAEGAVFLTTYRVIFTGMPTDPLVGEQVVVRSFPVAA
LTKEKRISVQTPVDQLLQDGLQLRSCTFQLLKMAFDEEVGSDSAELFRKQLHKLRYPPDI
RATFAFTLGSALTPGRPPRVTKDKGPSFRTLSRNLVKNAKKTIGRQYVTRKKYNPPGWEH
RGQPPPEDQEDEISVSEELEPSTLTPSSALKPSDRMTMSSLVERACCRDYQRLGLGTLSS
SLSRAKSEPFRISPVNRMYAICRSYPGLLIVPQSIQDNALQRVSRCYRQNRFPVVCWRSG
RSKAVLLRSGGLHGKGVVGLFKAQNTPSPGQAQADSSSLEQEKYLQAVVSSMPRYADSSG
RNTLSSFSSAHMGGHVPSPRARVTTLSNPLAASASRWTASRGKWSSVRASGRSSGLGADV
GSRLAGRDLLSTPHTNGAPPDSGFLRPQRAALYIIGDKAQLKGVRPDPLQQWELVPIEVF
EARQVKASFKKLLKACVPGCPATEPSPASFLRSLEDSEWLIQIHKLLQISVLVVELLDSG
SSVLVSLEDGWDITTQVVSLVQLLSDPFYRTLEGFRLLVEKEWLSFGHRFSHRGAHTLAG
QSSGFTPVFLQFLDCVHQVHLQFPMEFEFSQFYLKFLGYHHTSRRFRTFLLDSDYERIEL
GLLYEEKGERRGQLACKSVWEYVDRLSKRTPMFYNYTYAPEDTEVLRPYSNVSNLKVWDF
YTEETLAEGPPYDWELAQGPPEPPEEERPDGGAPQSRRRVVWPCYDSRPRVQPDAISRLL
EELQRLETELGRPSERWKETWDRVKAAQRLEGRQDGRGTPSSLLVSAVPHHRRSLGVYLQ
EGPVGSTLSLSLDSDQSSGSTTSSSRQAARRSTSTLYSQFQTAESENRSYEGTLYKKGAF
MKPWKARWFVLDKTKHQLRYYDHRVDTECKGVIDLAEVEAVAPGTPTIGAPKTVDEKAFF
DVKTTRRVYNFCAQDVPSAQQWVDRIQSCLSDA
NT seq 5682 nt   +upstreamnt  +downstreamnt
atggcgcggctcgcggactacttcgtgctggtggcgttcgggccgcacccgcgcgggagt
ggggaaggccagggccagatcctgcagcgcttcccggagaaggactgggaggacaaccct
ttcccccagggcattgagctgttttgccagcccagtgggtggcagctatgtcccgagagg
aatccaccaactttctttgtggctgtccttactgacatcaactctgagaggcactactgc
gcctgcttgaccttctgggagccagtggagtccacacaggaagtgatgtgcactgaagat
gccacagagaaggaggaagaggcacatggaggaggccaagcacagctgtcatccacagcc
ccagcccaacctggccagctttttgctccaaagactctggttctggtgtctcgactggac
catgctgacgtgttcaggaatagccttggtctcatctataccatccatgtggaaggcctg
aacgtgaacctggagaatgtgattgggaatctgctcacgtgcaccgtccccttggcaggc
gggtctcagagaaccatctctttgggggctggtgaccggcaggtcattcagaccccactg
gtagactcactgcctgtcagccgctgtagtgtagccctgctcttccgccagctgggcatc
accaatgtgctgtctttgttctgtgctgccctcactgagcacaaagtcctcttcttgtcc
aggagctaccaacgtctagccgatgcttgcaggggcctcttggcactgctgtttcctctc
agatacagcttcacatatgtgcccatcctgccggcacagctgctcgaagtccttagtaca
cctacacctttcatcattggggtcaatgcagccttccaggcagagactcaggagctgctg
gacgtgattgttgccgatcttgatggagggacagtgactgtccctgagtgtgtgcacatt
ccacccctgccagagccactacaaagccagactcacaatgttctgagcatggtcctggat
ccagagctggagttggctgaccttgcctttccaccacctacaacatctgcttcctcactg
aaaatgcaggacaaggagctccgcgctgtctttctgcggctctttgctcagctcctgcag
ggttaccgctggtgcctgcacatcgtgcgcatccaccccgagcctgtcattcgcttccat
aaggcagcgttcttaggccagcgtggactggtggaggatgatttcctgatgaaagtgttg
gagggcatggcctttgcaggctttgtgtcagagcgtggggtcccctaccgttctacagac
ctgtttgatgagttggtggctcatgaggtagcacggatgcgagcagatgagaaccatccc
caccgcgtcctgcgtcacgtccaagaactagcagagcaactttataagaatgaaaacccg
tacccagctgtggcaatgcataaagtgcagaggccaggagaggccagccacctgcggcgg
acccatcggccattcccccggctagatgagggcacagttcagtggattgtggaccaggct
gcagccaagatgcagggtgcacctccagctgtgaaggctgaaaggaggaccactgtccct
tcagggccccccatgacggccatcctagagcggtgcagtgggcctcacatcaacagtgcc
cgtcgcctggaggtggtgcgcaactgcatctcctacgtgtttgaagggaaaatgcttgag
gcaaagaagttgcttccagctgttctcagggccctgaaggggcgagctgcccgccgctgc
ctcgcccatgagcttcacctgcacgtacagcagaaccgtgcagttctggatcatcagcag
tttgactttgtcgtccgcatgatgaattgctgcctgcaggattgcacttctctggatgag
cacggcattgcggctgcactgctgcctttggtcacagccttctgcaggaagctgagccca
ggggtaacgcagtttgcatatagctgtgttcaggagcatgtagtgtggagcacaccacag
ttctgggaggccatgttctatggggatgtgcagacccatatccgggccctctacctggag
ccttctgatggcgtgagccccacccaggagactggggaggcacagtctcaggatgatgaa
cgatctgccctggatgtggcttcagagcagaggcgcctatggccaaccctgagccgtgag
aagcagcaggaactggtacagaaggaggaaagcactgtgttcagccaggccatccactat
gccaaccgcatgagctaccttctgctgcctctggacagcagcaagagccggctgctgcgg
gagcgggcagggttgggagacctggagagtgccagcaacagcctggtcaccaacagcatg
gcaggcagtgtggctgagagctatgacacagagagcggctttgaagacgcagagacatgc
gatgtggctggggctgtggtccgcttcataaaccgctttgtggacaaggtctgcacagag
agtggggtcaccagcgaccacctcaaaggactgcatgtcatggtgccagacattgtccag
atgcacattgagaccctggaggctgtacaccgtgagagcaagaggctgcccccaatacag
aagcccaagctgctgaggccacgcctattgcctggtgaagagtgtgtcctcgatggcctt
cgggtgtacctgctgccagatgggcgtgaggagggtgtaggaggcagtggagggggccct
gctctacttccagctgagggtgctgtcttccttaccacataccgcgtcatcttcacgggg
atgcctactgaccccctggtgggggagcaggtggttgtccgctccttccccgtggctgcg
ttgaccaaggagaagcgcattagtgtgcagacccctgtggaccagcttctgcaggacggg
ctgcagcttcgttcctgcacattccagctgctgaaaatggcctttgatgaggaggtggga
tctgacagtgctgagctcttccgaaagcagctccacaagcttcggtacccaccagacatc
agggccacctttgcattcacacttggctcagctctcacacctggcaggccgccacgagtt
accaaggacaagggtccttcattcagaaccctgtccaggaacctggtgaagaatgctaaa
aagaccattgggcggcagtatgttactcgtaagaaatataacccccctggctgggaacat
cggggccagccaccccctgaggaccaggaggacgagatatcagtgtcagaggagctggag
cccagcacactgaccccgtcctcagccctgaagccctctgaccgcatgaccatgagcagt
ctggtggaacgggcatgttgccgtgactaccagcgtcttggactaggtaccctgagcagc
agcctgagccgggccaagtctgagccctttcgcatctctcctgttaatcgcatgtatgcc
atatgtcgcagctatccaggattgctgattgttccccagagcatccaggacaatgccctg
caacgcgtgtcccgttgctaccgccagaaccgtttccctgtggtctgctggcgcagtggg
cgctccaaggctgtgttgctacgctctgggggcctgcatggcaaaggtgttgttggtctc
ttcaaggcccagaatacaccttctccaggccaggcccaggctgactccagcagcctagag
caagagaagtacctgcaggctgtggttagctccatgccacgttatgctgactcatcagga
cgaaacacacttagtagcttctcctcagcccacatgggtggtcacgtgcccagtccccga
gccagggtcaccacgctgtccaaccctttggcggcctcggcctccagatggactgcgtcc
cgaggtaagtggagcagtgtccgagccagtggtcgaagcagtgggcttggtgctgatgtg
ggctctcggctggctggcagagacctcctcagtactccccacaccaacggagcgccacct
gattctggttttctgcggccgcagcgtgcagccctctacatcattggtgacaaagctcag
ctcaagggtgtgcgcccagaccctttgcaacagtgggagctggttcctattgaagtattt
gaggcaaggcaggtgaaagccagcttcaagaaattgttgaaggcctgtgtgcctggttgc
cctgccactgagcccagcccagcctcctttctgcggtcactggaggactcagagtggctg
atccagatacacaagctgctgcagatatcggtgctggtggtggagctgctagactcaggc
tcctctgtccttgtgagcctggaggatggctgggacatcaccactcaggtggtatccttg
gtgcagctcctctcagaccccttctaccgcactctggaaggcttccgcctgctagtggaa
aaggagtggctgtcctttggccatcgtttcagccaccgtggggcccacaccctagctggg
cagagcagtggcttcacacccgtcttcctgcagttcctggactgtgtacaccaggtccat
ttgcagttccccatggagtttgagttcagtcagttctacctcaagttccttggttatcac
cacacatcccgccgtttccggaccttcttgctggactctgattatgagcgtattgagctg
ggactgctgtatgaggagaagggtgagcgcagaggccagttggcttgcaagtctgtgtgg
gaatatgtagaccggctaagcaagaggacccccatgttctacaactacacatatgcacct
gaggacacagaggtgctgcggccctacagcaatgtgtccaacctgaaggtgtgggatttc
tacactgaggagacgctggctgaggggcccccttatgactgggagctggcccaggggcct
cctgagcctccagaagaggagcgtcctgatggaggtgctccccagagcaggcgccgtgtg
gtttggccgtgctatgacagccgccctcgagtccagcctgatgccatctcacgtctgctg
gaggagctgcagcgattggagacagagctgggacggccttctgaacgctggaaagagacc
tgggaccgagtgaaagctgctcagcgccttgaaggccggcaagatggacgtggtacccct
agctcattactggtgtcagctgtgccccaccaccgccgctcgctaggggtctatctacag
gaggggcctgtgggctctactcttagcctcagcctggacagtgaccagagcagtggctca
accacatccagctctcgtcaggctgcccgacggagcaccagcacgctgtatagccaattc
cagacagcggagagtgagaacaggtcctatgagggcaccctgtacaagaagggagccttc
atgaagccctggaaagcccgttggtttgtcctggacaagaccaagcaccagctgcgttac
tatgaccaccgagtggacacagaatgcaagggtgtcattgacctggcagaggtggaagct
gtggcacctggcacacccaccataggtgcccctaagactgtggatgagaaggccttcttc
gatgtgaagacaacacgtcgtgtttacaacttctgtgcccaggatgtgccctcagcccag
cagtgggtggaccggatccagagctgcctgtcggatgcctga

DBGET integrated database retrieval system