KEGG   Rattus norvegicus (rat): 300149
Entry
300149            CDS       T01003                                 

Gene name
Ncaph2
Definition
(RefSeq) non-SMC condensin II complex, subunit H2
  KO
K11490  condensin-2 complex subunit H2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    300149 (Ncaph2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Chromosome condensation proteins
   Condensin II
    300149 (Ncaph2)
SSDB
Motif
Pfam: CNDH2_C CNDH2_N CNDH2_M
Other DBs
NCBI-GeneID: 300149
NCBI-ProteinID: NP_001020048
RGD: 1565937
Ensembl: ENSRNOG00000009598
UniProt: Q4V8I2
Position
7q34
AA seq 554 aa
MNFIEAALLIQGSACVYSKKVEYLYSLVYQALDFISGKRRAKQLSLVQEDGSNRAVNSGT
PCETEDEFLSLDDFPDSRANVDLKNDQASSELLIIPLLPMALVAPDEVEKSSNPLYSCQG
EVLASRKDFRMNTCTPDPRGSFMLDPVGMCPVEPVDVHPMPRSQKDAEEAEEQPMAVSRN
GSPVSVRSISQEPDGPALSSGDEDAEDVAELPEVALEPAEPRTSQQTAILPRRYMLRERQ
GAPEPASQPQETPDPWQSLDPFDSLDSKLFQKGKPYSVPPGVEEAPGQKRKRKGATKLQD
FHQWYLDAYAEHPDGRRARRKGPSFADMEVLYWKHVKEQLETLQKLRRRKMTERWLPGAK
QDLWPAEEERLEEPLEDLGVADDFLEAEEYVEESEGVMPREAAGLDAEAIPESLKYEELV
RRNVELFIATSQKFIQETELSQRIRDWEDTIQPLLQEQEQHVPFDIHTYGDQLVSRFPQL
NEWCPFAELVAGQPAFEVCRSMLASLQLANDYTVEITQQPGLEAAVDTMSLRLLTHQRAH
MRFQTYAAPSMAQP
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgaacttcattgaggcagcactgttgatccagggttcagcctgtgtctacagtaaaaag
gtggaatacctctactcgctggtctaccaggctctcgactttatctcaggcaagaggcga
gccaagcagctttctttagtgcaggaagatgggagcaaccgggctgtcaactcagggact
ccctgtgaaacagaggatgagttcctgtcactggatgacttccccgactcccgggctaac
gtggatctgaaaaatgaccaggcatccagtgaactgcttatcattccccttctgcccatg
gccctggtggcccctgatgaagtggaaaagagcagcaaccccttgtacagctgtcagggt
gaggtcttggccagccggaaggatttcaggatgaacacatgtacccccgaccccagaggt
tcctttatgttggatccagtgggaatgtgtcctgtggagcctgtagacgtgcaccccatg
ccaaggagccagaaagatgctgaggaggctgaggagcagccgatggcagtgtcgaggaac
gggagtcctgtgtctgtgcgcagcatctcccaagagccagatggcccagcgctcagcagt
ggagatgaggacgcagaggatgtagcagagctcccggaggttgctctagagcctgcagag
cccaggacctcacagcagactgccatcttgccaaggagatacatgcttcgggaacggcaa
ggggccccggaacctgcctcccagccgcaggagaccccagacccctggcaaagcctggac
ccttttgactccttggactctaagctcttccagaaaggtaaaccctattctgtgccaccc
ggtgtggaggaggctccaggacagaagcgcaaaaggaagggtgccaccaagttgcaggac
ttccaccagtggtacctggatgcctatgctgaacaccctgacggcaggagggctcggcgg
aagggcccaagctttgcagacatggaagtcctgtattggaaacacgtaaaagaacagctc
gagacccttcagaagctgcggagacgtaagatgaccgagagatggctacctggggccaag
caggacctgtggcctgcagaggaggaacgcttggaagagcccctagaagacctaggggta
gcagatgactttctagaggccgaagagtacgtagaagagtctgagggggtgatgcctagg
gaagctgctggcctagatgcagaggccataccagagtccctgaaatacgaggagctggtc
cgaaggaatgtggaactcttcattgccacctcccagaagtttattcaggagacggagctg
agccagcgcatcagggactgggaagataccatccagcccctgctccaggagcaggagcag
catgtgccctttgatatccacacctacggggaccagttggtttcacggttcccccagctc
aatgaatggtgcccctttgcagagcttgtggctgggcagcctgcttttgaggtgtgccgc
tccatgctggcttccttgcaactggccaatgactatacggtggagatcacccagcagcca
ggcctggaggcagctgtagacacgatgtctctgagactgctcacacatcagcgagcccac
atgcgcttccagacctatgctgccccatctatggcccagccttga

DBGET integrated database retrieval system