KEGG   Rattus norvegicus (rat): 300177
Entry
300177            CDS       T01003                                 

Gene name
Irak4
Definition
(RefSeq) interleukin-1 receptor-associated kinase 4
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04722  Neurotrophin signaling pathway
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    300177 (Irak4)
   04064 NF-kappa B signaling pathway
    300177 (Irak4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    300177 (Irak4)
   04621 NOD-like receptor signaling pathway
    300177 (Irak4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    300177 (Irak4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    300177 (Irak4)
   05161 Hepatitis B
    300177 (Irak4)
   05171 Coronavirus disease - COVID-19
    300177 (Irak4)
   05164 Influenza A
    300177 (Irak4)
   05162 Measles
    300177 (Irak4)
   05168 Herpes simplex virus 1 infection
    300177 (Irak4)
   05169 Epstein-Barr virus infection
    300177 (Irak4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    300177 (Irak4)
   05135 Yersinia infection
    300177 (Irak4)
   05133 Pertussis
    300177 (Irak4)
   05152 Tuberculosis
    300177 (Irak4)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    300177 (Irak4)
   05140 Leishmaniasis
    300177 (Irak4)
   05142 Chagas disease
    300177 (Irak4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    300177 (Irak4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    300177 (Irak4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     300177 (Irak4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  IRAK family
   300177 (Irak4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Haspin_kinase Death Kdo
Other DBs
NCBI-GeneID: 300177
NCBI-ProteinID: NP_001100261
RGD: 1305303
Ensembl: ENSRNOG00000005965
UniProt: D4A7K4
Position
7
AA seq 461 aa
MSKPLTPSTYVRSLNVGILRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTCELLFDWGTTNCTVGDLVDLLIQIELFAPATLLLPDAVPQAVHSLPPREAATV
AQAHRPCQEKNRTTVTPALAQKLEPSCELPDSSSPGHQSVEFSDTRFHSFSFYELKSITN
DFDERPVSIGGNRMGEGGFGVVYKGCVNNTTVAVKKLGAMVEISTEELKQQFDQEIKVMA
KCQHENLVELLGFSSDSDNLCLVYAYMPNGSLLDRLSCLDGTPPLSWHMRCKIARGAANG
IRFLHENHHIHRDIKSANILLDQDFTAKISDFGLARASAKLAQTVMTSRIVGTTAYMAPE
ALRGEITPKSDIYSFGVVLLELITGLAAVDENREPQLLLDIKEEIEDKEKTIEDCTDEKM
SDADPASVEAMYSVASQCLHEKKNRRPDIAKVQQLLQETSA
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgagcaagcctttgacaccgtcaacgtacgtacgcagcctcaatgttggaatcctcagg
aagctgtcggattttattgatccccaagaaggctggaagaaactagcagtagctattaaa
aagccatcgggtgatgacagatacaatcagttccatataaggagattcgaagccctactt
cagactggaaagagccccacttgtgaactgctgtttgactggggcaccacgaactgcaca
gtgggcgaccttgtggatcttctgatccagattgagctgtttgcccctgccactctcctg
ctgccagatgctgttccccaagccgtccacagcctacctcctagagaagcagcaacagtg
gcgcaggcacacaggccctgccaggaaaagaacaggacaaccgtaacgcctgcgcttgcg
cagaagctagaacccagctgtgagctgcccgactcctccagtccaggccatcaaagtgta
gaatttagcgacactcgatttcacagtttctcattttatgaactgaagagcatcacgaat
gacttcgacgagcgacctgtgtctatcgggggcaaccgaatgggagaggggggatttgga
gtggtgtacaaaggctgtgtgaacaacacaaccgtagcggtgaagaagcttggagcaatg
gtggaaatcagtactgaagaactaaagcaacagtttgaccaagaaattaaagtaatggcc
aagtgtcagcacgaaaacctggtggagctgctgggcttctcgagcgacagtgacaacctg
tgcttagtgtatgcttacatgcccaatggttccttgctagacagactgtcctgcctggac
ggaacgccaccactttcctggcacatgagatgcaagattgctcggggtgcagcaaacggc
atccgttttttgcatgaaaatcatcatattcacagagatattaaaagtgcaaatatctta
ctagaccaagactttactgccaaaatatctgactttgggcttgcacgggcttccgcgaag
cttgcacaaacggtcatgaccagccgaattgtgggcacaacggcttatatggcacctgaa
gctttgcgaggagaaataacacccaaatctgacatctacagcttcggtgtggttttattg
gagctgataaccggacttgcggctgtggatgaaaaccgcgaacctcaactactactggat
attaaagaagagattgaagacaaggagaagacgatcgaagattgcacagacgagaagatg
agcgatgcggaccctgcgtcggtcgaggcgatgtactctgttgctagccagtgtctgcac
gagaagaaaaacagacggccagacattgcaaaggttcaacagctgctacaagagacctct
gcataa

DBGET integrated database retrieval system