KEGG   Rattus norvegicus (rat): 300206Help
Entry
300206            CDS       T01003                                 

Gene name
Kansl2, RGD1303127
Definition
(RefSeq) KAT8 regulatory NSL complex subunit 2
  KO
K18401  KAT8 regulatory NSL complex subunit 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    300206 (Kansl2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     300206 (Kansl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3Hc3H zf-TRM13_CCCH
Motif
Other DBs
NCBI-GeneID: 300206
NCBI-ProteinID: NP_001004244
RGD: 1303127
Ensembl: ENSRNOG00000060185
UniProt: Q6AY70
Position
7q36
AA seq 488 aa AA seqDB search
MNRIRIHVLPTNRGRITPVPRSQEPLSCSFTHRPCSQPRLEGQEFCLKHILEDKNAPFKQ
CSYISTKNGKRCPSAAPKPEKKDGVSFCAEHARRNALALHAQMKKSNPGPMGETLLCQLS
SYAKTELGSQTPESSRSEASRILDEDSWSDGDQEPITVDQTWRGDPDSEADSIDSDQEDP
LKHAGVYTAEEVALIMREKLIRLQSLYIDQFKRLQHLLKEKKRRYLHNRKVEHEALGSSL
LTGPEGLLAKERENLKRLKCLRRYRQRYGVEALLHRQLKERRMLATEGAAQQAHTTRSSQ
RCLAFVDDVRCSNQSLPMTRHCLTHICQDTNQVLFKCCQGSEEVPCNKPVPVSLSEDPCC
PLHFQLPPQMYKPEQVLSVPDGLEAGPMDLYLSAAELQPTESLPLELSDDLDVVGDGMPC
PPSPLLFDPSLTLEDHSVTEIAGGPGQIQVAGDGCRSQGPHNVEKTCAPFPQRGLATANG
KPEPTSIS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggattcggattcacgtcttgccaacgaatcgggggaggatcaccccagtgccc
agatctcaggagcccctctcttgttcgttcactcaccgcccatgctctcagccgcgtctg
gaggggcaggagttttgtcttaagcatattcttgaagacaagaatgcacccttcaaacaa
tgtagttacatttcgacgaagaatgggaagaggtgccccagtgctgccccaaagcctgag
aagaaagatggggtgtctttctgtgctgaacatgctcgaaggaatgccctagcacttcat
gctcaaatgaagaagagtaacccaggccctatgggtgaaaccctcttgtgccagttgagc
tcatatgctaaaacagagctgggctcgcagaccccagagagtagccgaagcgaggcgagc
cggatactggatgaagacagctggagtgatggggaccaggaacccattactgtggatcag
acatggagaggtgaccctgacagtgaagctgatagcatagacagtgatcaagaagatccc
ctaaaacatgcgggtgtctatacagccgaggaggtggctcttatcatgagagaaaagctg
attcgtttgcagtctttgtacattgatcagtttaaacgactacagcacctgctcaaagag
aagaagcgccgttacttacataatcggaaagtggaacacgaagctttaggtagtagtctc
ctgactggccccgagggacttttggccaaagagagagagaatttaaagcgactaaaatgt
ctcaggcgataccgtcaacgctatggagtagaagccttactacacaggcagctgaaggaa
cgcagaatgctggccacagagggggctgctcaacaggctcataccactcgttccagtcag
aggtgcttagcctttgtggatgatgttcgctgctccaatcagtctcttccgatgaccaga
cactgccttacccatatctgtcaggatacaaatcaggttctcttcaaatgctgccaggga
tctgaagaggtaccctgtaacaaaccagttcctgtaagcctttctgaggacccctgctgt
ccactgcacttccagttgcctcctcagatgtataagcccgagcaggtactgtctgtgcca
gacggtctggaagccggccccatggatctgtacttgagtgctgccgagcttcagcccact
gagagcttaccactggagctcagtgacgacttggatgtcgtaggtgatggcatgccgtgc
cctccatcgcccttgctctttgatccctccctaactctagaagatcattccgtcactgaa
attgccggaggcccaggacagatacaggtggctggggatgggtgcagatcccagggacct
cataatgtagagaaaacctgtgcaccattccctcagcgtggattggctactgcaaatgga
aaaccagagcccacttctatcagttga

DBGET integrated database retrieval system