KEGG   Rattus norvegicus (rat): 300228
Entry
300228            CDS       T01003                                 

Gene name
Lima1, eplin
Definition
(RefSeq) LIM domain and actin binding 1
  KO
K23026  LIM domain and actin-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    300228 (Lima1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     300228 (Lima1)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 300228
NCBI-ProteinID: NP_001178544
RGD: 1564050
Ensembl: ENSRNOG00000059801
UniProt: F1LR10
Position
7q36
AA seq 755 aa
MESTPFNRRQWTSLSLRVTAKELSLVNKNKSSTIVEIFSKYQKAAEEANMERKKNNTESL
PQHFRRGTLSVLKKKWENPVAGAESHTDSLPNSSSDGGHTADHPPAEVTAKAAPGARADR
EEHTQPRSRFGSRPEAVTQCRYPRSEDSHDFKAQATESQNMENCLGDSRHEAEKPEMSEN
TETSGKIEKYNVPLNRLKMMFEKGEHSQNKSPWTQGRNAGGRRLSENSCSLDDLEIGAGH
LSSSAFNSEKNESKRNLELPRLSETSIKDRMAKYQAAVSKQSSPASYASELKPSESKTHK
WEQKENVPPGPEACSIHQEGSKVSATENSLVAHPVPAEDDTCNSQGRSEAQQPIYTKPLS
PDARTSSLPESSPSKTAKKFQAPARESCVECQKTVYPMERLLANQQVFHISCFRCSYCNN
KLSLGTYASLHGRIYCKPHFNQLFKSKGNYDEGFGHKQHKDLWASKGENEETLGRPAQPP
SAGETPHSPGVEDAPIAKVGVLAASMEAKASSQREREENKPAETKKLRIAWPPPAEQGSS
GSAPEEGFKVSKPKWPPEDEVCKTEAPEDVDLDLKKLRRSSSLKERSRPFTVAASFRTSS
VKSPKPLSPSLRKGWSEPEPEQSEEFGGGTVTQTESPRPSREKESVGKSRWQSEEAEAEA
EEAPRGRDGRSFELESESFIGNGASIAEDDVAPAQRSPLEPESPGWPGFGDTTTAKEFNQ
KSQDVGFWEGEVVRELSVEEQIKRNRYYDEDEDEE
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggaatcgactccgtttaatagacggcagtggacttccctgtcactgagagtaacagcc
aaagaactttctctcgtcaacaagaacaagtcgtccacaattgtggaaatattctccaag
taccagaaagcagctgaagaagcaaacatggaaaggaagaaaaataacactgaaagtctc
ccgcagcactttagaagagggaccctgtctgtgttaaagaagaagtgggagaaccccgtg
gcgggagcggaatcccacacagactcactgccaaacagcagcagcgacggtgggcacacg
gcggaccaccctcctgctgaagtgacagccaaggctgctcctggagccagagctgaccgg
gaagagcacacccagcccagatctagatttggatctcgtccggaagctgttactcagtgt
cggtatccccgctcagaggacagccacgattttaaagcccaggccacggaaagccaaaat
atggaaaactgtctgggagattccaggcatgaagcagagaagcccgaaatgagcgaaaac
acggaaacttcaggcaaaatagagaaatacaacgttccactgaacagactaaagatgatg
tttgagaaaggtgaacacagccaaaacaagagtccctggacccagggccgaaatgcaggc
ggaaggaggctctctgaaaacagctgttccctggacgatttggaaataggtgcaggtcat
ttgtcttcctctgccttcaactcggagaaaaatgagagtaagcggaatctggagctgcca
cgcctctctgagacctccataaaggaccgcatggccaagtaccaggctgccgtgtccaag
cagagcagcccagccagctacgcaagtgagctgaaacccagtgaaagcaaaactcacaaa
tgggagcagaaggagaacgtgccccccggccccgaggcctgcagcatccatcaggaaggg
agcaaggtttctgcaactgagaatagcctggtggcccaccctgtccctgcagaagatgac
acctgtaactcccaggggaggagtgaggcccagcagcccatatacactaagccgctgagt
cccgacgccaggacctccagtcttccggaaagttctccttccaaaacagcgaagaagttt
caggcacccgcaagagagagctgcgtggagtgtcagaagacggtgtatcccatggaacgg
ctcctggccaaccagcaggtgtttcacatcagctgtttccgatgctcctactgcaacaac
aaactcagtctaggaacatatgcatccttacacggaagaatctattgtaagcctcacttc
aaccaactcttcaagtccaaaggcaactatgacgaaggctttgggcacaagcagcataag
gatctgtgggcaagcaaaggtgaaaatgaagagactttggggagaccagcccagcctccc
agtgcaggggagaccccccatagcccgggtgtagaagatgcccccatcgccaaggtcggc
gtgctggctgcgagtatggaagccaaggcctcctctcagagggagagggaagagaataag
ccagcggagaccaagaagctgaggatcgcctggcctcccccagccgagcagggcagttca
ggaagtgccccggaggaagggttcaaagtgtcaaagcccaagtggcctcccgaggatgaa
gtctgcaagacagaggcgccggaggatgtagatctggacctgaagaagctgaggcgctct
tcgtccctgaaggagaggagccgcccgtttactgtcgcggcttcctttcgaacctcctcg
gtcaagagccccaagcccttgtcgccgtccctcaggaagggttggagcgagccggagccc
gagcagagtgaggagttcggaggagggacagtgacacaaacggaaagccccaggccctct
cgggagaaggagagtgtgggaaaatcacgctggcagagcgaggaagcggaagcggaagcg
gaggaagcgccgaggggcagggacggtcgttcttttgagctggagagtgagagttttata
ggaaatggcgcaagcatagctgaagacgacgtcgccccagcacagcggtctccattagaa
cccgagtctccgggttggcctggctttggagacaccacgactgctaaagaattcaatcaa
aaatcccaagatgtcgggttctgggagggggaagtggtccgagagctgtccgtggaggag
cagataaagagaaaccggtactatgacgaggatgaggatgaggaatga

DBGET integrated database retrieval system