KEGG   Rattus norvegicus (rat): 300240
Entry
300240            CDS       T01003                                 

Gene name
Atg101
Definition
(RefSeq) autophagy-related protein 101 isoform 2
  KO
K19730  autophagy-related protein 101
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04136  Autophagy - other
rno04140  Autophagy - animal
rno04211  Longevity regulating pathway
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    300240 (Atg101)
   04136 Autophagy - other
    300240 (Atg101)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    300240 (Atg101)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    300240 (Atg101)
   05014 Amyotrophic lateral sclerosis
    300240 (Atg101)
   05016 Huntington disease
    300240 (Atg101)
   05017 Spinocerebellar ataxia
    300240 (Atg101)
   05022 Pathways of neurodegeneration - multiple diseases
    300240 (Atg101)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    300240 (Atg101)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    300240 (Atg101)
SSDB
Motif
Pfam: ATG101
Other DBs
NCBI-GeneID: 300240
NCBI-ProteinID: NP_001258043
RGD: 1359310
Ensembl: ENSRNOG00000007756
Vega: OTTRNOG00000001633
UniProt: Q6AY69
Position
7
AA seq 218 aa
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGIQDVDCDFI
DFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWE
VWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMSRHEYLPKMPTQSELDNVFDT
GLRDVQPYLYKISFQITEALGTSVTTTMRRLIKDTLAL
NT seq 657 nt   +upstreamnt  +downstreamnt
atgaactgtcgatcagaagtgctggaggtgtcggtggaggggcggcaggtggaggaggcc
atgctggccgtgctgcacacagtgctgcttcaccgcagcacaggcaagtttcactacaag
aaggagggcacgtactccatcggcaccgtgggcatccaggatgtagactgtgacttcatc
gacttcacatatgtgcgtgtctcctccgaggagctggaccgcgccttgcgcaaggttgtt
ggggaattcaaggatgcactgcggaactcaggcggcgatgggctgggccagatgtccttg
gaattctaccagaagaagaagtctcgctggcctttttcggatgagtgcatcccctgggag
gtgtggactgtcaaggtgcacgtggtagccctggccacagagcaggagcggcagatctgc
agagagaaggtgggagagaagctgtgtgagaagattatcaacatcgtggaggtgatgagc
cggcacgagtacctgcccaagatgcccactcagtcagagctggacaacgtgtttgacacg
ggcttgcgggacgtgcagccctacctctacaagatctcctttcagatcaccgaggccctg
ggcacctcagtcaccaccactatgcgcaggctcatcaaagacacccttgccctatag

DBGET integrated database retrieval system