KEGG   Rattus norvegicus (rat): 300242
Entry
300242            CDS       T01003                                 

Gene name
Krt7, Krt2-7
Definition
(RefSeq) keratin 7
  KO
K07605  type II keratin, basic
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    300242 (Krt7)
   04147 Exosome [BR:rno04147]
    300242 (Krt7)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     300242 (Krt7)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   300242 (Krt7)
  Exosomal proteins of other body fluids (saliva and urine)
   300242 (Krt7)
  Exosomal proteins of colorectal cancer cells
   300242 (Krt7)
  Exosomal proteins of bladder cancer cells
   300242 (Krt7)
SSDB
Motif
Pfam: Filament Keratin_2_head CENP-F_leu_zip TPR_MLP1_2 TSNAXIP1_N ATG16 Spc7 ADIP DUF2125 FPP CALCOCO1 DUF812 Taxilin
Other DBs
NCBI-GeneID: 300242
NCBI-ProteinID: NP_001041335
RGD: 1310865
Ensembl: ENSRNOG00000008057
Vega: OTTRNOG00000001637
UniProt: Q6IG12
Position
7q36
AA seq 457 aa
MSIHFSSRSTAYPGRGAQVRLSSGRASFGSRSLYGLGSSRPRVAVRSAYGGPVGAGIREI
TINQSLLAPLSVDIDPTIQQVRQEEREQIKTLNNKFASFIDKVRFLEQQNKMLETKWALL
QEQKSAKSSQLPRIFEAQIAGLRQQLETLQLDGGRLEVELRNMQDVVEDFKNKYEEEINR
RTAAENEFVLLKKDVDAAYTNKVELEAKADSLQDEINFLKTLHETELAELQSQISDTSVV
LSMDNSRSLDLDGIIADVKAQYEEMANHSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRN
EIAEMNRSIQRLQAEIDTLKNQRAKLESSIAEAEEQGELAIKDAHAKQGELEAALQKAKQ
DVARQLREYQELLNTKLALDIEIATYRKLLEGEESRLSGDGMGPVNISVVNSTGGNGGKL
IFGGTMGSNALSFSGGPGALRAYSIKTTSTTRRGTHN
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgtccatccacttcagctctcgctccactgcttacccgggccgcggggctcaggtgcgc
ctgagctcgggccgcgccagcttcggcagcaggagcctctatggcctgggctcatcaagg
cctcgtgtggccgtgcgctccgcttatgggggcccggtgggcgctggcatccgcgagatc
accatcaatcagagcttgctggcgccgctgagtgtggacatcgatcccaccatccagcag
gtgcgccaggaggagcgcgagcagatcaagaccctcaacaacaaattcgcctccttcatc
gacaaggtacgcttcctggaacagcagaacaagatgctggagaccaagtgggcgctgctg
caggaacagaagtcagccaagagcagccagcttccccgaatctttgaggctcagattgct
gggctgaggcagcagctcgagacactgcagctggatgggggccgcctggaggtggaactg
cggaacatgcaggatgtggtggaagatttcaagaataagtatgaagaggagatcaaccga
cgcacggctgctgagaatgagtttgtgttgctgaagaaggatgtggatgccgcctacacg
aacaaggtggagttggaggccaaggcggacagtctgcaggatgagatcaacttcctcaag
acccttcacgagacagagttagcagagctgcagtcgcagatctcagacacatctgtggtg
ctgtccatggacaacagccgctccctggacttggatggtatcattgctgacgtcaaagcc
cagtatgaggagatggccaaccacagccgggcagaggctgaagcttggtaccagaccaag
tttgagacactccaggcccaggctgggaagcacggggatgacctccgcaacacccggaat
gagattgcggagatgaaccgctctatccagaggctgcaggcagagattgacaccttgaag
aaccagcgtgccaagttagagtccagcatcgcagaggctgaggaacaaggggagctggca
atcaaggatgctcatgctaagcagggggagctggaggctgccctgcagaaggccaagcag
gatgtggcccggcaacttcgagagtaccaggagctcctgaacaccaagctggcgctggac
attgagatcgccacctaccgcaagctgctggagggcgaggagagccggttgtctggagac
ggaatgggacctgtgaatatctctgttgtgaattccactgggggcaatggtggcaagctt
atcttcggaggaaccatgggaagcaatgctctgagcttcagtgggggacccggagccctc
agggcctattccatcaagaccacatctactacccgcaggggcacccacaattga

DBGET integrated database retrieval system