KEGG   Rattus norvegicus (rat): 300257
Entry
300257            CDS       T01003                                 

Gene name
Pfdn5
Definition
(RefSeq) prefoldin subunit 5
  KO
K04797  prefoldin alpha subunit
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    300257 (Pfdn5)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  GimC
   300257 (Pfdn5)
SSDB
Motif
Pfam: Prefoldin PHM7_cyt ING TRAF_BIRC3_bd BORCS7 DcrB KASH_CCD DUF5320
Other DBs
NCBI-GeneID: 300257
NCBI-ProteinID: NP_001100264
RGD: 1311436
Ensembl: ENSRNOG00000012985
UniProt: B5DFN4
Position
7q36
AA seq 154 aa
MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGK
ELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPA
LQEKHAMKQAVVEMMSQKIQQLTALGATQATAKA
NT seq 465 nt   +upstreamnt  +downstreamnt
atggcgcagtcgattaacatcacggagctgaatctgccacaactggaaatgctcaagaac
cagctggaccaggaagtggagtttttgtccacgtcaattgctcagctcaaggtggtacag
actaagtatgtggaagccaaggactgtctgaacgtgctgaacaagagcaacgagggaaaa
gaattactggtcccactgacgagttctatgtatgtccccgggaagctccacgatgtggaa
catgtgcttatcgatgtgggaactggttactacgtggagaagacagctgaggatgccaag
gacttcttcaaaaggaagatagactttcttaccaaacagatggagaaaatccagccagct
ctgcaggagaagcatgccatgaaacaagccgtcgtggaaatgatgagccagaagattcag
cagctcacagccctgggggcaacgcaggccactgccaaggcatga

DBGET integrated database retrieval system