KEGG   Rattus norvegicus (rat): 300361
Entry
300361            CDS       T01003                                 

Gene name
Cwc15
Definition
(RefSeq) spliceosome-associated protein CWC15 homolog
  KO
K12863  protein CWC15
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    300361 (Cwc15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    300361 (Cwc15)
Spliceosome [BR:rno03041]
 Complex B
  Other components
   Prp19 complex
    300361 (Cwc15)
 Complex C
   Prp19-CDC5 complex
    300361 (Cwc15)
SSDB
Motif
Pfam: Cwf_Cwc_15 UPF0524
Other DBs
NCBI-GeneID: 300361
NCBI-ProteinID: NP_001020158
RGD: 1310669
Ensembl: ENSRNOG00000008490
UniProt: Q5BJP2
Position
8
AA seq 229 aa
MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFR
RELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEE
SDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQA
NFKVKRRWDDDVVFKNCAKGIDDQKKDKRFVNDTLRSEFHKKFMEKYIK
NT seq 690 nt   +upstreamnt  +downstreamnt
atgacaacagcagccaggccaacttttgaacctgcaagaggtgggagaggaaaaggagaa
ggtgatttgagccagctctccaagcagtattcaagcagagaccttccctctcatacaaag
ataaagtacagacaaaccacacaggatgcccctgaagaggttcgcaaccgtgacttcagg
agagagttggaagagagggagagagctgctgcaagggagaaaaatagggaccgtccaacc
cgagaacacacaacttcctcttcggtgtccaagaagccccgcttagaccagattcctgct
gccaaccttgatgctgacgatcctctcacagatgaggaagatgaggattttgaagaggaa
agcgatgacgatgacactgcagctcttcttgcagagctagaaaagatcaagaaggagaga
gctgaagagcaggccagaaaggagcaagaacaaaaagcagaggaagagagaattcgcatg
gaaaacattctgagtggaaaccctctcctgaatctcacgggcccgtcccagcctcaggcc
aacttcaaggttaaaagaaggtgggacgatgatgttgtttttaagaactgtgcaaagggt
atagatgatcaaaagaaagacaaaagatttgtaaacgatacgctgcgatctgaatttcac
aaaaagttcatggagaaatatatcaagtag

DBGET integrated database retrieval system