KEGG   Rattus norvegicus (rat): 300407Help
Entry
300407            CDS       T01003                                 

Gene name
Olr1146, ratchr8-17624320-17625249_ORF
Definition
(RefSeq) olfactory receptor 1146
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    300407 (Olr1146)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    300407 (Olr1146)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    300407 (Olr1146)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx SRI
Motif
Other DBs
NCBI-GeneID: 300407
NCBI-ProteinID: XP_017451668
RGD: 1333020
Position
8q13
AA seq 600 aa AA seqDB search
MRGQLWGRVFCFGVSFFLLLRSSAVPGAPVSLVSQASFFASAKLVGYLLVPGPILGLRGL
GGVRPALLGPSHGRAEACIQFLLAQGWGQVVAVFGGLFCSASLRSVHLTRRGLGLSSRGR
GGQKLLRPGSAGCGGTFRVTQNSGPDPREDFCFGCVTASQGSFLAAGSWSAYLVVPGGPQ
VRARGDCHRALCQRRTRRPACAPFRSFVAPGSPMGLGFFLCVLGSSGGVVSTFEKVLMCA
LSRFRGKQSPAPPPLPWMGVVRLPDPSPSCTPSRPPDSRSPTGGQLWDSVSARRCSFSSP
TEFILLGLTDDPELQLILFGIFLFIYLVTVLGNIIIILAVSLDSHLHTPMYFFLCNLSFT
DICFITSTVPKMLMNIQRQSNAISYADCITQMYFVVFLSGMENFLLAAMAYDRYVAICHP
LRYTVMMNPSICIVLTLLSIFSSMIDALLHILLVLRLSFCTYLEIPQFFCELAHIIKLSC
SDTLINNIVVYMATFIFGGLPFWGIILSYVKIVYSVLKKPSIRGNYKALSTCGSHLSVVF
LFYGSVIGVYISFAVTDSTRKTAVASVLYTVVPQMLNPFVYSLRNKDMKEAVKKLSGVIM
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaggggtcagttatggggaagagtgttctgcttcggggtgtcgtttttccttcttcta
cggtcttcagctgttcctggggcccctgtgtctttggtgtcccaggccagcttttttgcc
agcgcaaagttggtcggttacctgctggtcccggggccaattctggggttgcgtggtctc
ggcggggtccgcccggccctcctggggccctcccacgggagggcggaggcctgtatacag
tttctcttggcgcagggatgggggcaggtggtggcagtgtttggtgggctcttctgctct
gccagcctcaggagtgtccacctgaccaggcgggggttgggtctctcctcaaggggtcgg
ggggggcagaagctgctgcggccgggatccgcggggtgtggggggactttccgggtaaca
cagaactctggcccggatcctagggaggacttctgcttcgggtgtgtcacagcctcacag
ggcagctttcttgcagcgggaagttggtccgcttacctggtggttcccggggggcctcaa
gttcgggctcgtggtgactgccaccgggctctctgccagaggcgcaccaggagacctgcc
tgcgcccccttccggagcttcgtggcaccaggttccccgatgggtcttggctttttcctc
tgtgtacttgggagtagtggcggtgtagtgagtacattcgagaaggtgttgatgtgcgcg
ctttcccggtttcggggcaaacagtcccctgccccgcctccccttccttggatgggtgtg
gtccgcctcccagacccgtcccccagttgcacgccctcccgccctccggactctagatct
cctactgggggtcagttatgggacagtgtttctgctcggcggtgtagtttttcctctcct
acagaatttattcttctgggactgacagatgatccagaactgcagctcattctttttgga
atcttcctcttcatatacctggtcacagtgctaggaaacatcatcattatcttggctgtc
agccttgactcccacctccacacccctatgtacttctttctctgtaacctatccttcact
gacatctgcttcatcaccagcactgtccccaagatgctgatgaacatccagagacagagc
aatgccatcagttacgcagattgcattacacagatgtactttgttgtttttcttagtgga
atggaaaactttcttcttgcagcaatggcttatgatcgctatgttgcaatctgccatcca
cttagatacacagtcatgatgaatccaagcatctgtattgtgctaaccttactctccatt
ttcagtagcatgatagatgccctattacacattttgttggtgttgcgactatccttctgc
acatatttagaaatcccccaattcttctgtgaactggctcatataatcaagctgtcatgt
tctgacactcttatcaataacatcgtggtatacatggcaactttcatatttggtggactt
ccattttggggcattattttatcttatgttaaaattgtctattcagtcttgaaaaagcct
tcaataagaggcaattacaaggccctttctacctgtgggtctcacttgtcagttgttttc
ctgttttatggttcagtgattggggtctatatcagctttgcagtgactgactcaactaga
aagactgcagtggcttcagtactgtatacggtggtccctcagatgctgaatccctttgtg
tatagtctaaggaacaaagacatgaaagaagctgtgaagaaattaagtggcgtgattatg
taa

DBGET integrated database retrieval system