KEGG   Rattus norvegicus (rat): 300443Help
Entry
300443            CDS       T01003                                 

Gene name
Plppr2, Lppr2, Prg-4
Definition
(RefSeq) phospholipid phosphatase related 2
  KO
K19581  lipid phosphate phosphatase-related protein type 1/2/5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99983 Lipid metabolism
    300443 (Plppr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 300443
NCBI-ProteinID: NP_001005881
RGD: 1597171
Ensembl: ENSRNOG00000012164
UniProt: F1LR33
Position
8q13
AA seq 343 aa AA seqDB search
MAGGRPHLKRSFSIIPCFVFVESVLLGIVILLAYRLEFTDTFPVHTQGFFCYDSAYAKPY
PGPEAASRAPPALIYALVTAGPTLTILLGELARAFFPAPPSASPVSGESTIVSGACCRFS
PPLRRLVRFLGVYSFGLFTTTIFANAGQVVTGNPTPHFLSVCRPNYTALGCPPPSPDRPG
PDRFVTDQSACAGSPSLVAAARRAFPCKDAALCAYAVTYTAMYVTLVFRVKGSRLVKPSL
CLALLCPAFLVGVVRVAEYRNHWSDVLAGFLTGAAIATFLVTCVVHNFQSRPLSGRRLSP
WEDLSQAPTMDSPLEKNPRPAGRIRHRHGSPHPSRRTVPAVAT
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggctggagggagacctcacctgaagcggagtttctccatcatcccctgctttgtcttc
gtggagtctgtgttgctgggcatcgtcatccttcttgcgtaccgcctggagttcacggac
accttccccgtgcacacgcagggcttcttctgctacgacagcgcttatgccaagccgtac
cctgggcccgaggctgccagccgagcaccccccgccctcatctatgccctggtcactgct
gggcccaccctcacgatccttctgggggaactggcccgtgccttcttccctgcgccaccc
tccgccagtcctgtcagtggggaaagcaccattgtgtccggggcctgctgccgcttcagt
cccccactgcggaggctggtccgattcctgggggtgtactcttttggcctcttcaccacg
accatctttgcaaatgcgggacaagtggtgaccggtaaccccacacctcacttcctgtcg
gtatgtcgccccaactacacggccctgggttgcccaccaccgtctcctgaccggccaggg
cctgaccgcttcgtcaccgaccagagcgcctgtgcaggcagtcccagcttggtggccgcc
gcacgccgcgccttcccctgcaaggatgcggccctgtgcgcctacgccgtcacctataca
gcgatgtacgtgaccctagtgtttcgcgtgaagggttctcgcctagtgaaaccttccctc
tgcctggccctgctgtgccccgccttcctggtgggcgtggtccgcgtggcagagtatcgc
aaccattggtcggacgtgctggctggctttctgactggagcagccatagccacctttttg
gtcacctgtgttgtgcacaatttccagagccgacccctctctggtcgaaggctctccccc
tgggaggacctcagccaggcccccaccatggacagccccctcgaaaagaacccgagacct
gcaggccgcattcgacaccggcacggctcaccccatccaagccgcagaactgtgcccgcc
gtggccacctga

DBGET integrated database retrieval system