KEGG   Rattus norvegicus (rat): 300445Help
Entry
300445            CDS       T01003                                 

Gene name
Prkcsh
Definition
(RefSeq) protein kinase C substrate 80K-H
  KO
K08288  protein kinase C substrate 80K-H
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    300445 (Prkcsh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:rno04091]
    300445 (Prkcsh)
Lectins [BR:rno04091]
 P-type lectins
  300445 (Prkcsh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRKCSH-like PRKCSH_1 PRKCSH EF-hand_5 EF-hand_1 EF-hand_6 Ldl_recept_a EF-hand_7
Motif
Other DBs
NCBI-GeneID: 300445
NCBI-ProteinID: NP_001100276
RGD: 1309628
Ensembl: ENSRNOG00000013360
UniProt: B1WC34
Position
8q13
AA seq 525 aa AA seqDB search
MLLLLLLLPLCWAVEVKRPRGVSLSNHHFYDESKPFTCLDGTATIPFDQVNDDYCDCKDG
SDEPGTAACPNGSFHCTNTGYKPLYILSSRVNDGVCDCCDGTDEYNSGTVCENTCREKGR
KEKESLQQLAEVTREGFRLKKILIEEWKTAREEKQSKLLELQAGKKSLEDQVETLRTAKE
EAERPEKEAKDQHRKLWEEQQAAAKARREQELAASAFQELDDNMDGLVSLAELQTHPELD
TDGDGGLSEEEAQALLSGDTQTDTTSFYDRVWAAIRDKYRSEVPPTDIPVPEVTEPKEEK
LPVLPPMEEEEEEEEPEEEEEEEEEEVPGEQPKEVPPPQQPLRPPSPAEDEKMPPYDEET
QAIIDAAQEARNKFEEVERSLKEMEESIRSLEQEISFDFGPSGEFAYLYSQCYELTTNEY
VYRLCPFKLVSQKPKHGGSPTSLGTWGSWAGPDDDKFSAMKYEQGTGCWQGPNRSTTVRL
LCGKETVVTSTTEPSRCEYLMELMTPAACPEPPPEVPTDGDHDEL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgctgctgctgctgctacccctctgttgggcagtagaagttaagagaccccgg
ggcgtttccctcagcaaccatcacttctatgacgaatctaaacctttcacgtgtttggat
ggcacagccactatccccttcgatcaggtgaacgatgattactgcgactgtaaggatggt
tctgatgagcctggcacagctgcgtgtcccaatggcagctttcactgcaccaacactggg
tataagcctttgtacatcctctctagccgggtcaatgatggggtgtgtgactgctgtgat
gggacggacgagtacaacagtggcaccgtctgtgagaacacctgcagagagaagggtcgc
aaggaaaaagagtccctgcagcagctggccgaggtcacccgagaagggttccgtctcaag
aagatactcattgaggagtggaagacagctcgggaagaaaagcagagtaagcttcttgag
cttcaggctggaaagaagtctctggaagaccaggtagaaacgctgcggacagcgaaagag
gaagcagagaggccagagaaggaggccaaggaccagcaccggaagctgtgggaagagcag
caggctgctgccaaggcccggcgggaacaggagctggcagccagtgccttccaggaactg
gacgacaacatggatgggctggtctcactggctgagttacagactcacccagagctggac
acagatggagatggaggactgtcggaggaggaggcccaggctcttctcagtggagacaca
cagactgacactacctccttctatgaccgtgtctgggctgccatcagggacaagtaccgc
tctgaggtcccacccacggacatacctgttcctgaggtcaccgaacccaaagaagaaaag
ctgccagtgttgccccccatggaagaggaggaggaagaggaggagccagaggaggaagag
gaggaggaggaggaggaggtgccgggggagcagcccaaggaggtcccgcccccacagcag
cccctacggcctcccagtcctgctgaggatgagaagatgccaccctatgatgaggagaca
caggctatcatcgatgccgcacaagaggcccggaacaagtttgaggaggtcgaacggtcc
ttgaaagagatggaggagtccatcaggagtttggaacaagagatctcctttgatttcggt
ccctctggagagtttgcatacctctacagccaatgctacgagctcaccaccaatgagtat
gtctaccggctttgccccttcaaacttgtctcccagaaacccaaacatgggggctccccg
accagtctgggtacatggggctcctgggctggcccagatgacgacaagttcagcgcaatg
aagtacgagcagggcacaggctgctggcagggccccaaccgctccaccacagtacgcctc
ctgtgtggcaaggagactgtggtgaccagtaccacagagcccagtcgctgcgagtacctc
atggagctgatgacaccagcagcctgcccagagccgcctccagaagtacccactgatgga
gaccatgatgaactgtag

DBGET integrated database retrieval system