KEGG   Rattus norvegicus (rat): 300458Help
Entry
300458            CDS       T01003                                 

Gene name
Npsr1, RGD1564154
Definition
(RefSeq) neuropeptide S receptor 1
  KO
K08376  neuropeptide S receptor 1
Organism
rno  Rattus norvegicus (rat)
Brite
G protein-coupled receptors [BR:rno04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neuropeptide S
    300458 (Npsr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 300458
NCBI-ProteinID: NP_001100278
RGD: 1564154
Ensembl: ENSRNOG00000015863
UniProt: A0A0H2UHN0
Position
8q13
AA seq 371 aa AA seqDB search
MPANLTEGSFHANQTVPMLDSSPVACTEIVTFTEALEAEEWGSFYSSFKTEQLITLWVLF
VFTIVGNSVVLFSTWRRKRKSRMTFFVTQLAITDSFTGLINILTDIIWRFTGDFMAPDLV
CRIVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQAKVLIGIAWSLSFLFSIP
TLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISVIYGLVIRTIWIK
SKAHETVISNCSDGELCCSYNRGLISKAKIKAIKYSIVIILAFICCWSPYFLFDMLDNFN
LLPDTKERFYASVIIQNLPALNSAINPLIYCIFSGSLCSPCKVQRSQDSRMTYRERSERH
EMQILSKPEFI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaacctcacagagggcagctttcatgccaaccagactgtgccgatgctagat
tcttcccctgtagcttgcactgaaattgtgactttcactgaagcgctggaggctgaggag
tggggctccttctactcgtcctttaagacagagcagctgataaccctgtgggtcctgttt
gtcttcactattgtgggaaactcggtcgtgctgttctccacatggagaagaaaaagaaag
tccagaatgaccttctttgtgactcaattggccatcacagactccttcacaggcctgatc
aacatcctgacagacattatttggcgattcacgggagacttcatggcccctgacctggtc
tgcagaatcgtccgctacttacaggttgtcctgctttatgcctctacctatgtcctggtg
tccctcagcatagacagataccatgccatcgtttaccccatgaaattccttcaaggagag
aagcaagccaaagtcctcatcggaatagcatggagcctctccttcctgttctccatcccc
acactgatcatatttgggaaaaggacactttccaatggtgaggtacagtgctgggcactg
tggccagacgactcctactggaccccatatatgaccatcgttgcctttctggtgtacttc
atccccttgacaattatcagcgtcatctatggccttgtgatccgaactatttggattaaa
agcaaagcccatgagacggtgatttccaactgctcagatggagaactatgctgcagctac
aaccgaggcctcatctcaaaagcaaaaatcaaggccatcaagtacagcatcgtcataatc
cttgctttcatctgctgctggagtccatacttcctctttgacatgttagacaacttcaac
ctccttccagacaccaaggagcgtttctatgcctctgtgattatccagaacctgcctgcc
ttgaacagtgccattaaccccctcatctactgcatcttcagcggctccctctgctccccc
tgcaaggtgcaaagatcccaggattccagaatgacgtaccgagagagaagcgagaggcat
gagatgcagattctctccaagcctgaattcatctaa

DBGET integrated database retrieval system