KEGG   Rattus norvegicus (rat): 300463
Entry
300463            CDS       T01003                                 

Gene name
Herpud2, RGD1307343
Definition
(RefSeq) HERPUD family member 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: ubiquitin DUF2407
Other DBs
NCBI-GeneID: 300463
NCBI-ProteinID: NP_001020159
RGD: 1307343
Ensembl: ENSRNOG00000029995
UniProt: Q66HH4
Position
8q13
AA seq 401 aa
MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSG
RLLPDHLQLKDILRKQDEYHMVHLVCASRSPPSSPKSSTDGESHGALASSTNSNSDHSDS
TTPSPSQESLSLVAGSSEGLRHRTLPQAQTDPAQSHQFPYVIQGNVDHQFPGQGVPPGFP
MYPAFSPLQMLWWQQMYAQQYYMQYQAAVTAQATSSASSAQHAASSPLNLAHVPGEEPPP
APNLVAQENGPENVQMNAQGGPVLNEEDFNRDWLDWVYTFSRAAVLLSIVYFYSSFSRFI
MVMGAMLLVYLHQAGWFPFRQEGGQQQAPNNVDANNEGQNANNLELEEMRLMDDGLEDES
GEDAGEDASAAQRPGLMASAWSFITTFFTSLIPEGPPQVAN
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggaccaaagtgggatggagattcctgttactctcatcattaaagcaccgaatcagaaa
tacagtgaccagactattagctgcttcttgaactggaccgtggggaaactaaaaacgcat
ctatctaacgtgtaccctagcaaaccattgacaaaagaccagaggttggtgtattctggc
agactacttcctgaccatctgcagctgaaagacattctcagaaaacaagatgagtatcat
atggttcatctagtctgtgcttctcggagtcctcccagttctccaaaatccagcaccgat
ggagaaagtcacggagcactggcatccagcaccaattctaattcagatcattctgattca
accactccatcacccagtcaagagagtttgtcactagttgctggttcttcagaaggattg
aggcaccgtactcttccacaagcacagactgacccagcccagagtcatcagtttccatat
gtaatccaaggaaatgtggatcaccagtttcctgggcaaggcgtgccccctgggttccca
atgtaccctgcgttcagccccctgcagatgctgtggtggcaacagatgtacgctcagcag
tattatatgcaatatcaagctgcagttacagctcaggccacgtcaagtgccagctcagcc
cagcatgctgcatcgtcacctctgaatttggcccatgttcctggagaagagcccccacca
gctcccaacctagtggcccaagaaaatgggcctgagaatgttcaaatgaatgcacagggc
ggcccagtgctaaatgaagaagacttcaaccgcgactggctggactgggtgtacacgttc
tcgcgagctgccgtcctcctcagcatcgtatacttctactcttcctttagtcggtttatc
atggtaatgggagccatgctgctggtttatttacaccaagctggatggtttcctttcagg
caagaaggcggtcaacaacaggctcccaacaatgttgacgctaacaacgaggggcagaat
gcaaacaacctagaacttgaagaaatgcgccttatggatgatggactcgaagatgagagt
ggagaagatgcaggtgaagatgccagtgcagctcaaaggcctgggctaatggcttccgct
tggtcttttatcaccaccttttttacttcactgataccagaggggcctccccaagttgcc
aattag

DBGET integrated database retrieval system