KEGG   Rattus norvegicus (rat): 300565
Entry
300565            CDS       T01003                                 

Gene name
Olr1240
Definition
(RefSeq) olfactory receptor 1240
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    300565 (Olr1240)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    300565 (Olr1240)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    300565 (Olr1240)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 300565
NCBI-ProteinID: NP_001000448
RGD: 1333265
Ensembl: ENSRNOG00000048549
UniProt: D3ZU37
Position
8q22
AA seq 310 aa
MASANVSLVTEFILVGLTNQPDLQIPLFFVFLIMYIVTALGNLCLIILIVLNSHLHTPMY
FFLFNLSFIDLCYSTVFTPKMLMNFILSKNAISYMGCLTKLYFFCFFVISECYVLTSMAY
DRFVAISNPLLYTVAMSPKLCLNLMLGTYLMAFSGAMAHTGCMLRLTFCDANTINHYFCD
ILPVMQLSCTSTYVNELVVFIVVGINIIVPSITIFISYGFILSSIFHIKSNEGRSKAFST
CSSHIIAVCLFFGSGAFMYLKPSSSSSMDQGKTSSVFYTNVVPMMNPLIYSLRNKDVKMA
LRKTLSRRKF
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcctctgcaaatgtctctttggtgactgaattcattctggtaggtttaacaaaccag
cctgatctccaaattcccctgttctttgtgtttctaataatgtatattgttactgcattg
ggaaatttgtgtctaataattcttattgtactaaattcacatctccacactcctatgtac
tttttcctctttaacttgtccttcatagatctctgctattctactgtgttcactccaaaa
atgctgatgaactttatattgagcaagaatgcaatttcttacatgggatgcttgaccaag
ctatatttcttttgtttttttgtcatttctgagtgttatgtgttgacttcaatggcttat
gatcgctttgtggccatctctaatccacttttgtacactgttgccatgtcccctaaattg
tgtttgaaccttatgcttggcacatatttaatggcattttctggtgccatggctcacaca
ggatgtatgctaagactgaccttctgtgatgctaacaccatcaaccattacttctgtgac
atcctccctgtgatgcagctctcatgcaccagcacctatgtcaatgaacttgtagttttc
attgtggtaggcatcaacatcattgtgcccagcatcaccatttttatctcttatggtttc
attctgtccagcattttccacatcaaatctaatgaaggcaggtccaaggccttcagcacc
tgcagttcccatataattgcagtttgtctgttctttggatcaggtgcatttatgtatctc
aaaccatcttcttcttcatcgatggatcaaggaaaaacctcttctgtattttataccaat
gtggttcctatgatgaatcccttaatctacagtttaaggaacaaagatgtaaaaatggcc
ctgagaaaaactctgagtagacggaaattttga

DBGET integrated database retrieval system