KEGG   Rattus norvegicus (rat): 300567Help
Entry
300567            CDS       T01003                                 

Gene name
Olr1242
Definition
(RefSeq) olfactory receptor 1242
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    300567 (Olr1242)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    300567 (Olr1242)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    300567 (Olr1242)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 300567
NCBI-ProteinID: NP_001000450
RGD: 1333059
Ensembl: ENSRNOG00000050448
UniProt: D4ACK5
Position
4q11
AA seq 311 aa AA seqDB search
MALGNWSFVTEFILIGLTEQPNLQLPLFFLFLVMYMVTITGNLGLVILIGLNSHLHTPMY
FFLFNLSLIDLCYSSVFTPKMLLNFILTKNIISYMGCMTQLYFYSFFVISECYVLMTMAY
DRYVAICNPLLYNIAMSPKICSYLLLGSYLMAFSGAMAHTGCMLRLTFCDANTINHYFCD
ILPVMQLSCTSTYVNELEVLIVVGINILVPSITIFISYGFILSSIFHINSNEGRSKAFST
CSSHIIAVSLFFGSGAFMYLKPSSVGSMDEGKISSVFYTNVVPMMNPLIYSLRNKDVKVA
LRKTLSRWKLW
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcccttggaaactggtcttttgtgactgaattcatcctgattggtttaacagaacaa
cccaatctccaactccctctcttcttcctgtttcttgtaatgtatatggtaacaataaca
gggaacttgggtttggtcattctaattgggctgaattcacaccttcatacccccatgtac
ttttttctctttaacttgtctttgatagacctctgttactcttcagtgtttacacccaaa
atgctgttgaacttcatattaactaagaatattatctcttatatggggtgtatgacccaa
ctctatttttattcattttttgttatttctgagtgttatgtattaatgacaatggcctat
gatcgttatgtggccatctgtaatccactcttatataatattgctatgtcccctaaaata
tgttcctatcttttgcttggttcatatttgatggcattttctggtgccatggcacacaca
ggatgcatgctcagactgaccttctgtgatgcaaacaccatcaaccactacttttgcgac
atcctaccagtgatgcagctctcctgcaccagcacctatgtaaatgaactggaggtttta
attgttgtgggcatcaatatccttgtgcccagcatcaccatttttatatcttatggtttc
attctctcgagcatcttccacattaactccaatgagggcagatccaaggccttcagcacc
tgcagctcccacattattgctgtttctctcttctttggatcaggtgcatttatgtacctt
aaaccctcttcagttgggtctatggatgaaggaaaaatttcctctgtcttttacaccaat
gtggttcccatgatgaatcccttaatctacagcttgaggaacaaagatgtaaaagttgcc
ctgaggaaaactttaagtaggtggaagctatggtaa

DBGET integrated database retrieval system