KEGG   Rattus norvegicus (rat): 300568
Entry
300568            CDS       T01003                                 

Gene name
Olr1243
Definition
(RefSeq) olfactory receptor 1243
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    300568 (Olr1243)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    300568 (Olr1243)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    300568 (Olr1243)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 300568
NCBI-ProteinID: NP_001000451
RGD: 1333764
Ensembl: ENSRNOG00000061259
UniProt: A0A0G2K370
Position
4q11
AA seq 310 aa
MALENASLVTEFILMGLTNQPELKIALFLLFLGMYMITTLGNLALIVLIVLNSQLHTPMY
FFLLNLSCIDLCYCSVITPKMLMSFIVKRNVISYEGCMTQFYFFAFFVISECYVLTAMAY
DRYVAICKPLLYNIVMSPKVCSYLMTGSYLVGFSGAMIHTGCILRLNFCDGNTINHYFCD
ILPLLQLSCTSTYVNEIELFIVAGKDIIVPTVIIFTSYGFILSSILKIRSTEGMSKAFST
CSSHIIAVSLFFGSCTFMYLKPSSVGSMDQGKISSVFYNIVVPMMNPLIYSLRNKDVKIA
LKKTITKRKF
NT seq 933 nt   +upstreamnt  +downstreamnt
atggctctggaaaatgcttccctggtcactgagttcatcttgatggggttaacaaaccag
cctgagctaaaaatagccctgttcctactctttctggggatgtacatgataactacattg
gggaatttggctttgatcgtactgattgttctaaattctcaacttcacactcccatgtac
tttttcctgcttaacttgtcctgcatagacctttgctactgttcagtcattacacctaaa
atgctgatgagtttcatagtaaagaggaatgtcatttcttatgagggatgcatgacccag
ttctacttctttgccttttttgttatatctgaatgttatgtgctgacagcaatggcctat
gatcgctacgtggccatttgtaagcccctcttgtacaacattgtcatgtctcctaaggtg
tgttcttatctaatgactggttcatatttggtggggttttctggtgccatgatccacact
ggatgtatccttagactgaatttctgtgatggaaacactatcaaccactatttctgtgac
atcctccctttgctccagctctcctgcaccagcacctatgttaatgagatagagttgttc
attgtagcaggaaaggatattattgtacccactgtgatcatctttacctcttatggcttc
atcttatccagcatactcaaaataaggtccacagaaggtatgtccaaagccttcagcaca
tgcagttcccacataattgctgtttctctgttctttggatcatgtacatttatgtatctt
aaaccctcctcagttggatctatggaccagggaaaaatatcttctgtcttttataacatt
gtggtccccatgatgaatccattaatctatagccttagaaacaaagatgttaaaattgct
ctgaaaaaaaccataaccaaaagaaagttttaa

DBGET integrated database retrieval system