KEGG   Rattus norvegicus (rat): 300666
Entry
300666            CDS       T01003                                 

Gene name
C2cd2l, Tmem24
Definition
(RefSeq) C2CD2-like
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: SMP_C2CD2L C2 PetN
Other DBs
NCBI-GeneID: 300666
NCBI-ProteinID: NP_001011996
RGD: 1310281
Ensembl: ENSRNOG00000009719
UniProt: Q5U2P5
Position
8q22
AA seq 706 aa
MDPDWGQRDVGWAALLVLFAASLLTVLGWLLQYARGLWLSRAGGGRDSRPASAAEPGGSL
RELGVWRSLLRLRATRSSAPEEAGVRGLLASLFAFKSFRENWQRAWVRALNEQACRDGSS
IQIAFEEIPQLPPRASISHVTCVDQSERTMVLHCQLAAEEVRFPISVTQQSPAAVSMETY
HVTLTLPPTQLEVSLEEIPDEGLLVSWAFTDRPDLSLKVLPKSQTRERDEEQPELSTVEE
LIKDAIVSTQPAMMVNLRACSAPGGLVPSEKPPTMSQAQPSIPRPTRLFLRQLRASHLGS
ELGGTEELCCAAELDNPMQQKWTKPTRAGSEVEWAEDLALDLGPQSRELTLKVLRSSSCG
DAELLGQATLPVGSPSKPLSRRQVCPLTPGPGKSLSPAAIVTVELHYEQGSPRNLGTPTS
STPRPSITPTKKIELDRTIMPDGTIVTTVTTVQSRPRVDGKLDSPSRSPSKVEVTEKMTT
VLSESSGPSNASHSSSRESHLSNGLDPVAETAIRQLTEPSGRAAKKTPTKRSTLIISGVS
KVPIAQDELALSLGYAASLEASMQDDAGASGGPSSPPSDPSATSPGPVDALSSPTSVQEA
DETTRSDISERPSVDDVESETGSTGALETRSLKDHKVSFLRSGTKLIFRRRPRQKEAGLS
QSHDDLSNTTATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggatccagactgggggcagcgggatgtgggctgggcggccctgctggtcctcttcgcc
gcctcgctgctcacggtattgggctggttgctgcagtatgcccggggtttgtggctgtcg
cgagccggtgggggccgagactctcgacccgcttcagctgccgagcccgggggttcattg
cgcgagctgggtgtgtggcgttcgctgctgcgtttgcgggcgacccggagcagcgccccc
gaggaagccggcgtacggggcctcctggcttcgctctttgccttcaagtctttccgggag
aactggcaacgggcttgggtgcgagccttgaatgagcaggcctgcagggacgggagctcc
atccaaatcgcctttgaggagataccccaactcccaccaagagccagcattagtcatgtg
acctgcgttgaccaatcagagcgtaccatggtgctgcactgccagctggctgctgaggag
gtgcgcttccccatctccgtgacccagcagtcccccgctgccgtctccatggagacctac
cacgtcactctgacactgccaccaacacagttggaagtcagccttgaggaaatccctgat
gaggggctgctggtgtcctgggccttcacggaccgcccagatctcagcctgaaggtgctt
cccaagtctcagactagggagagagatgaggaacaaccagagctttcaacagttgaggaa
ctgatcaaggacgctatcgtcagcactcagcccgccatgatggtcaacctcagggcctgc
tctgccccaggaggcctggtacccagtgagaagccacccacgatgtcccaggcccagcca
tccatccccagacctacccgactattcttacggcagcttcgagcatctcacctgggaagt
gagctaggaggtactgaggaactgtgctgtgctgctgagcttgacaaccccatgcaacag
aagtggaccaaacccacaagggctggctctgaggtggaatgggcagaggatttagctctg
gatctgggtccccagagccgggagctgaccctcaaagtgctcaggagcagcagttgtgga
gatgctgaactccttggccaagccacactgcctgtgggctcaccttccaaaccactgtca
cggaggcaagtgtgtccactgactccagggcccgggaaatccctgagcccagcggccatc
gtgacagtggagctacactatgagcagggctctcctcggaatctgggcacgcccacctct
tccacccctcgccccagcatcacacccaccaagaagattgagttggaccggaccatcatg
cctgatggcacaatcgtcaccactgttactactgtgcagtcccgcccccgtgtagatggc
aaactagactccccctcccgctccccgtccaaggtggaggtgactgagaagatgacaact
gtgctgagtgagagcagcggccccagcaatgcctcccacagtagcagccgggagagccac
ctttccaatggcttggatccagtagcagagacagcaatccgccagctgacggagcccagt
gggcgggcagccaagaagacacccaccaagcgcagcacgctcatcatctctggtgtttcc
aaggtgcccatcgctcaggacgagttggcactctccttgggttatgcagcatctctggaa
gcctcaatgcaagatgatgcaggagccagtggtggtccttcatcacctccctcagacccc
tcagccacatccccaggacccgttgatgctctctccagtcccacaagtgtccaggaagca
gacgagacaacacgttcagacatttctgagaggccgtcggtggatgatgttgagtcagaa
acagggtctactggtgccctggagacccgaagcctcaaggatcacaaagtgagtttcctg
cgaagtggcactaagctcatcttccgccggcggccccgacagaaggaagcgggtctgagc
cagtcgcacgatgacctgtccaacacaacagccacacctagtgtccggaagaaggctggc
agcttttcccgtcgccttatcaagcgtttttccttcaagtccaaacccaaggccaatggc
aaccctagcccccagctctga

DBGET integrated database retrieval system