KEGG   Rattus norvegicus (rat): 300676
Entry
300676            CDS       T01003                                 

Gene name
Ttc36
Definition
(RefSeq) tetratricopeptide repeat domain 36
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: TPR_2 TPR_1 TPR_12 TPR_11 TPR_16 TPR_8 TPR_10 TPR_9 TPR_7 TPR_19 HemY_N TPR_17
Other DBs
NCBI-GeneID: 300676
NCBI-ProteinID: NP_001005546
RGD: 1359544
Ensembl: ENSRNOG00000014700
UniProt: Q66H45
Position
8q22
AA seq 186 aa
MGTPNDQAVLQAILNPNTPFGDVVGLDLEETEEGDEDGVFPQAQLEQSKALELQGVRAAE
AGDLHTALERFGKAISLLPERASAYNNRAQARRLQGDVAGALEDLERAVTLSGGRGRAAR
QSFVQRGLLARFQGRDDDARRDFEQAARLGSSFARRQLVLLNPYAALCNRMLADMMGQLS
APSNGR
NT seq 561 nt   +upstreamnt  +downstreamnt
atggggactccaaatgatcaggcagtgctgcaggccatcctcaaccctaatacccccttt
ggagatgttgttggattggacctggaagaaacagaggagggagatgaagatggagttttc
cctcaagcacagttggagcaatccaaggccctggagttgcagggagtgagggcagcagaa
gctggggacctccacacagccctggagaggtttggcaaagccattagcctgctacctgag
agagcctctgcgtacaacaaccgtgcccaagcgaggcggctccagggggatgtagcaggc
gccctagaggacttggagcgcgcggtgacgttgagcggcggccggggtcgcgccgcccgc
cagagcttcgtgcagcgcgggctgctggcacgatttcagggtcgggacgacgatgcccgc
agagacttcgagcaggcggcgagactgggcagctcgttcgcacggcgccagttggtgctg
ctcaatccgtacgccgcgctgtgcaatcgcatgctggccgacatgatggggcagctgagc
gcgcccagtaacgggcgctga

DBGET integrated database retrieval system